|
|
|
|
|
|
|
| Information on 1olp_A_94 |
|
Loop code: 1olp_A_94 PDB: 1olp Chain: A Type: HH alpha-alpha |
Loop Start: 94 Loop Length: 2 Sec Struct Nt length: 18 Sec Struct Ct length: 18 Structure geometry
|
| Sequence: | AESQTRKFATLAKNEWDKGNYEKAAWYLGQGMHYFGDL |
| Sec Struct: | HHHHHHHHHHHHHHHHHHT-HHHHHHHHHHHHHHHHHH |
| PDB ligands within a cut-off distance of 6 Å in this loop |
| Ligands | Residue | atSS | atLOOP |
| ZNZINC ION | H - 126 | 1 | 0 |
| ZNZINC ION | Y - 127 | 1 | 0 |
| ZNZINC ION | G - 129 | 1 | 0 |
| ZNZINC ION | D - 130 | 1 | 0 |
| PDB Site Annotation |
| Site | Residue | atSS | atLOOP |
| BC2ZN BINDING SITE FOR CHAIN A | H - 126 | 1 | 0 |
| AC9ZN BINDING SITE FOR CHAIN A | D - 130 | 1 | 0 |
| BC2ZN BINDING SITE FOR CHAIN A | D - 130 | 1 | 0 |
| Associated ArchDB95 Subclass to 1olp_A_94 |
| For any comment or web-related incidence, send an email to the webmaster. |
|