|
|
|
|
|
|
|
| Information on 1olp_A_146 |
|
Loop code: 1olp_A_146 PDB: 1olp Chain: A Type: HH alpha-alpha |
Loop Start: 146 Loop Length: 15 Sec Struct Nt length: 13 Sec Struct Ct length: 4 Structure geometry
|
| Sequence: | PGHVKFETYAEERKDTYRLDTTGYNTDDAFYK |
| Sec Struct: | HHHHHHHHHHHHHGGGG--S--SS-TTSHHHH |
| PDB ligands within a cut-off distance of 6 Å in this loop |
| Ligands | Residue | atSS | atLOOP |
| ZNZINC ION | H - 148 | 1 | 0 |
| ZNZINC ION | E - 152 | 1 | 0 |
| PDB Site Annotation |
| Site | Residue | atSS | atLOOP |
| BC1ZN BINDING SITE FOR CHAIN A | H - 148 | 1 | 0 |
| BC1ZN BINDING SITE FOR CHAIN A | E - 152 | 1 | 0 |
| Associated ArchDB95 Subclass to 1olp_A_146 |
| For any comment or web-related incidence, send an email to the webmaster. |
|