|
|
|
|
|
|
|
| Information on 1gnx_A_179 |
|
Loop code: 1gnx_A_179 PDB: 1gnx Chain: A Type: HH alpha-alpha |
Loop Start: 179 Loop Length: 11 Sec Struct Nt length: 9 Sec Struct Ct length: 25 Structure geometry
|
| Sequence: | PWCSAFLGYGSGVHAPGRTDPVAALRAAHHLNLGHGLAVQALRDR |
| Sec Struct: | HHHHHHHHHTS-SSTT----HHHHHHHHHHHHHHHHHHHHHHHHH |
| PDB ligands within a cut-off distance of 6 Å in this loop |
| Ligands | Residue | atSS | atLOOP |
| SUCSUCROSE | Q - 218 | 1 | 0 |
| PDB Site Annotation |
| Site | Residue | atSS | atLOOP |
| AC2SO4 BINDING SITE FOR CHAIN A | R - 204 | 1 | 0 |
| AC1SUC BINDING SITE FOR CHAIN A | Q - 218 | 1 | 0 |
| Associated ArchDB95 Subclass to 1gnx_A_179 |
| For any comment or web-related incidence, send an email to the webmaster. |
|