|
|
|
|
|
|
|
| Information on 1oep_A_106 |
|
Loop code: 1oep_A_106 PDB: 1oep Chain: A Type: HH alpha-alpha |
Loop Start: 106 Loop Length: 3 Sec Struct Nt length: 19 Sec Struct Ct length: 9 Structure geometry
|
| Sequence: | ANAILGCSMAISKAAAAAKGVPLYRYLASLA |
| Sec Struct: | HHHHHHHHHHHHHHHHHHHTS-HHHHHHHHH |
| PDB ligands within a cut-off distance of 6 Å in this loop |
| Ligands | Residue | atSS | atLOOP |
| EDO1,2-ETHANEDIOL | P - 127 | 0 | 1 |
| EDO1,2-ETHANEDIOL | Y - 129 | 1 | 0 |
| EDO1,2-ETHANEDIOL | R - 130 | 1 | 0 |
| PDB Site Annotation |
| Site | Residue | atSS | atLOOP |
| AC4EDO BINDING SITE FOR CHAIN A | Y - 129 | 1 | 0 |
| AC6EDO BINDING SITE FOR CHAIN A | R - 130 | 1 | 0 |
| Associated ArchDB95 Subclass to 1oep_A_106 |
| For any comment or web-related incidence, send an email to the webmaster. |
|