|
|
|
|
|
|
|
| Information on 1iwp_B_129 |
|
Loop code: 1iwp_B_129 PDB: 1iwp Chain: B Type: HH alpha-alpha |
Loop Start: 129 Loop Length: 15 Sec Struct Nt length: 15 Sec Struct Ct length: 18 Structure geometry
|
| Sequence: | LETYRQIGKNAARYARKESPSPVPVVNDQMVRPKFMAKAALFHIKETK |
| Sec Struct: | HHHHHHHHHHHHHHHTT-----------TTHHHHHHHHHHHHHHHHHH |
| PDB ligands within a cut-off distance of 6 Å in this loop |
| Ligands | Residue | atSS | atLOOP |
| B12COBALAMIN | V - 154 | 0 | 1 |
| B12COBALAMIN | N - 155 | 0 | 1 |
| B12COBALAMIN | V - 159 | 0 | 1 |
| B12COBALAMIN | R - 160 | 1 | 0 |
| B12COBALAMIN | F - 163 | 1 | 0 |
| B12COBALAMIN | M - 164 | 1 | 0 |
| B12COBALAMIN | A - 167 | 1 | 0 |
| B12COBALAMIN | A - 168 | 1 | 0 |
| B12COBALAMIN | H - 171 | 1 | 0 |
| For any comment or web-related incidence, send an email to the webmaster. |
|