Information on SUBCLASS 16.7.1 |
Subclass Accession number: 5169
Subclass: 16.7.1 Type: HH alpha-alpha DB: ArchDB95 Image coordinates: Consensus coordinates: Conserved Annotation EC : - (>75 %) 3 (>75 %) GO : GO:0000287 (>75 %) GO:0004518 (>75 %) GO:0004519 (>75 %) GO:0016788 (>75 %) SCOP : 53045 (>75 %) 88722 (>75 %) 88723 (>75 %) |
Number of loops: 3 Average sequence ID (%) : 55.0 +/- 0.5 Average RMSD (Å) : 0.500 +/- 0.265 Consensus geometry
|
Consensus Sequence: | pXIRXXDGpPLXcppGpITS |
(φψ)-conformation: | aapbpaalpppbpaalppaa |
Pattern: | [AG] | [FLM] | [N] | [AT] | [IL] | [Y] | [Q] | [F] | [IL] | [ST] | x | [I] | [R] | x | [KPR] | [D] | [G] | [ST] | [P] | [L] | [KMR] | [DN] | [RS] | [KQ] | [G] | [ER] | [I] | [T] | [S] | x | [LY] | [NS] | [G] | [ILV] | [FL] | [Y] | [KR] | [TV] | x | [HN] | [LM] | [LMV] | [E] |
Conservation: | -0.728 | -0.900 | 1.360 | -0.828 | -0.352 | 1.942 | 0.779 | 1.360 | -0.363 | -0.550 | -1.546 | 0.198 | 0.779 | -1.320 | -1.159 | 1.360 | 1.360 | -0.466 | 1.942 | 0.198 | -1.159 | -0.063 | -1.119 | -0.343 | 1.360 | -0.644 | 0.198 | 0.779 | 0.198 | -0.749 | -0.906 | -0.443 | 1.360 | -0.577 | -0.515 | 1.942 | -0.075 | -0.720 | -1.485 | 0.150 | -0.267 | -0.771 | 0.779 |
Loops included in this Subclass |
Loop | PDB | Chain | Start | End | Sequence | Sec Struct | Ramachandran |
1a77_*_28 | 1a77 | - | 28 | 70 | GMNALYQFLTSIRLRDGSPLRNRKGEITSAYNGVFYKTIHLLE | HHHHHHHHHHHSB-TTS-B-B-TTS-B-HHHHHHHHHHHHHHH | aaaaaaaaaaaxbxaavxxxbxaavxxaaaaaaaaaaaaaaaa |
1b43_A_27 | 1b43 | A | 27 | 69 | ALNAIYQFLSTIRQKDGTPLMDSKGRITSHLSGLFYRTINLME | HHHHHHHHHHHSB-TTS-B-B-TTS-B-HHHHHHHHHHHHHHH | aaaaaaaaaaabbxaavxxxbxaavxxaaaaaaaaaaaaaaaa |
1rxw_A_28 | 1rxw | A | 28 | 70 | AFNTLYQFISIIRQPDGTPLKDSQGRITSHLSGILYRVSNMVE | HHHHHHHHHHHSB-TTS-B-B-TTS-B-HHHHHHHHHHHHHHH | aaaaaaaaaaaxbxaavpxxbxaavxxaaaaaaaaaaaaaaaa |
PDB ligands within a cut-off distance of 6 Å in this subclass |
Loop | PDB | Chain | Ligands | Residue |
1a77_*_28 | 1a77 | * | MGMAGNESIUM ION | M - 29 |
1a77_*_28 | 1a77 | * | MGMAGNESIUM ION | N - 30 |
Clusters included in this Subclass |
CLUSTER: HH.16.7 |