Information on SUBCLASS 4.33.1 |
Subclass Accession number: 4843
Subclass: 4.33.1 Type: HH alpha-alpha DB: ArchDB95 Image coordinates: Consensus coordinates: |
Number of loops: 3 Average sequence ID (%) : 38.9 +/- 15.2 Average RMSD (Å) : 0.333 +/- 0.058 Consensus geometry
|
Consensus Sequence: | LXGPhHGh |
(φψ)-conformation: | aapaaFaa |
Pattern: | [LPY] | [HY] | x | [AS] | [FIV] | [ALT] | [AG] | [AG] | [IM] | [GN] | [AG] | [L] | [AK] | [G] | [P] | [IL] | [H] | [G] | [GL] | [A] | [NV] | [EQ] | [AE] | [AV] | [ILM] | x | [QTW] | [FL] | x | [EQ] |
Conservation: | -1.290 | 1.014 | -0.937 | -0.176 | -0.470 | -0.997 | -0.253 | -0.255 | -0.091 | 0.118 | -0.259 | 0.585 | -0.495 | 1.640 | 2.167 | 0.093 | 2.695 | 1.640 | -1.068 | 0.585 | -0.721 | 0.351 | -0.427 | -0.400 | -0.177 | -1.232 | -0.880 | -0.053 | -1.056 | 0.351 |
Loops included in this Subclass |
Loop | PDB | Chain | Start | End | Sequence | Sec Struct | Ramachandran |
1a59_*_205 | 1a59 | - | 205 | 234 | LHSAVTGAIGALKGPLHGGANEAVMHTFEE | HHHHHHHHHHHHHSTTTTTHHHHHHHHHHH | aaaaaaaaaaaaapaaFaaaaaaaaaaaaa |
1aj8_A_207 | 1aj8 | A | 207 | 236 | YYSAILAGIGALKGPIHGGAVEEAIKQFME | HHHHHHHHHHHHHSTTTTTHHHHHHHHHHH | aaaaaaaaaaaaapaaFaaaaaaaaaaaaa |
1csh_*_258 | 1csh | - | 258 | 287 | PYLSFAAAMNGLAGPLHGLANQEVLLWLSQ | HHHHHHHHHHHHTSTTTTTHHHHHHHHHHH | aaaaaaaaaaaaaxaaFaaaaaaaaaaaaa |
PDB ligands within a cut-off distance of 6 Å in this subclass |
PDB Site Annotated loops in this subclass |
Loop | PDB | Chain | Site | Residue |
1aj8_A_207 | 1aj8 | A | ACACATALYTIC RESIDUES. | H - 223 |
Clusters included in this Subclass |
CLUSTER: HH.6.187 |