|
|
|
|
|
|
|
| Information on SUBCLASS 8.23.1 |
|
Subclass Accession number: 5052
Subclass: 8.23.1 
Type: HH alpha-alpha DB: ArchDB95 Image coordinates: 
 Consensus coordinates:
Conserved Annotation GO : GO:0005212 (>50 %) SCOP : 48556 (>75 %) 48557 (>75 %) 48558 (>75 %) |
Number of loops: 3 Average sequence ID (%) : 91.4 +/- -75.8 Average RMSD (Å) : 0.100 +/- 0.000 Consensus geometry
|
| Consensus Sequence: | EQYTAhGGTAKS |
| (φψ)-conformation: | aapappgpapaa |
| Pattern: | x | x | x | x | x | x | x | x | x | x | x | x | x | x | x | x | x | x | x | x | x | x | x | x | x | x | x | x | x | x | x |
| Conservation: | -2.280 | -0.444 | 1.391 | -0.444 | -0.444 | 0.474 | 0.474 | 2.309 | 0.474 | -0.444 | -1.821 | 1.391 | 1.391 | 0.474 | -0.444 | 0.474 | -0.444 | -0.444 | -0.444 | 0.474 | -2.050 | 0.474 | -0.444 | 0.474 | 0.474 | -0.444 | 0.474 | 0.474 | -0.444 | -1.132 | 0.474 |
| Loops included in this Subclass |
| Loop | PDB | Chain | Start | End | Sequence | Sec Struct | Ramachandran |
| 1hy0_A_430 | 1hy0 | A | 430 | 460 | FVNSVEQYTALGGTAKSSVTTQIEQLRELMK | HHHHHHT--STTSSSHHHHHHHHHHHHHHHH | aaaaaaaxappgxaxaaaaaaaaaaaaaaaa |
| 1i0a_A_430 | 1i0a | A | 430 | 460 | VVNSVEQYTAVGGTAKSSVTAQIEQLRELLK | HHHHHTT--STTSSSHHHHHHHHHHHHHHHH | aaaaaaaxaxpvxaxaaaaaaaaaaaaaaaa |
| 1k7w_A_432 | 1k7w | A | 432 | 462 | FVNSVEQYTALGGTAKSSVTTQIEQLRELMK | HHHHHTT--STTSSSHHHHHHHHHHHHHHHH | aaaaaaaxappvxaxaaaaaaaaaaaaaaaa |
| Clusters included in this Subclass |
| CLUSTER: HH.9.69 |
| For any comment or web-related incidence, send an email to the webmaster. |
|