Logo
Information on SUBCLASS 1.4.6
Subclass Accession number: 1035
Subclass: 1.4.6 PSSM
Type: EH beta-alpha
DB: ArchDB40

Image coordinates: Rasmol PDB Jmol PDB
Consensus coordinates: Rasmol PDB Jmol PDB

Conserved Annotation
EC : 5.2 (>50 %)  5.2.1 (>50 %)  5.2.1.8
GO : GO:0003755 (>75 %)  GO:0016853 (>75 %)  GO:0016859 (>75 %)  
SCOP : 50890 (>75 %)  50891 (>75 %)  50892 (>75 %)  
 Number of loops: 3

Average sequence ID (%) : 37.5 +/- 14.7
Average RMSD (Å) : 0.200 +/- 0.000

Consensus geometry
d (Å): 7 delta (°): 45-90 theta (°): 90-135 rho (°): 0-45
Consensus Sequence: XpGMc
(φψ)-conformation: ablaa
Pattern: [V][F][AG][EKQ][V][IKV][DEK][G][M][DGN]x[AV][DEK][AIK][ILM][EK]
Conservation:0.6331.822-0.048-0.2260.633-1.150-0.4241.8221.227-0.556-1.150-0.484-0.424-1.547-0.2260.099
Loops included in this Subclass
LoopPDBChainStartEndSequenceSec StructRamachandran
1ihg_A_1481ihg   A148163VFGQVIKGMGVAKILEEEEEEEE-HHHHHHHHxNbbxabvaaaaaaaa
1lop_A_1221lop   A122137VFAEVVDGMDEVDKIKEEEEEEE-HHHHHHHHxabbxabvaaaaaaaa
2cpl_*_1282cpl   -128143VFGKVKEGMNIVEAMEEEEEEEE-HHHHHHHHxNbbxabvaaaaaaaa
PDB ligands within a cut-off distance of 6 Å in this subclass
LoopPDBChainLigandsResidue
1ihg_A_1481ihg   A     GOLGLYCEROL M - 156
1ihg_A_1481ihg   A     GOLGLYCEROL G - 157
1ihg_A_1481ihg   A     GOLGLYCEROL K - 160

Clusters included in this Subclass
CLUSTER: EH.1.69