Logo
Information on SUBCLASS 2.1.27
Subclass Accession number: 1067
Subclass: 2.1.27 PSSM
Type: EH beta-alpha
DB: ArchDB40

Image coordinates: Rasmol PDB Jmol PDB
Consensus coordinates: Rasmol PDB Jmol PDB

Conserved Annotation
EC : 2.7 (>75 %)  2.7.2 (>75 %)  2.7.2.3
GO : GO:0004618 (>75 %)  GO:0016301 (>75 %)  GO:0016772 (>75 %)  GO:0016774 (>75 %)  
SCOP : 53747 (>75 %)  53748 (>75 %)  53749 (>75 %)  
 Number of loops: 3

Average sequence ID (%) : 14.6 +/- 19.0
Average RMSD (Å) : 0.533 +/- 0.153

Consensus geometry
d (Å): 9 delta (°): 45-90 theta (°): 135-180 rho (°): 135-180
Consensus Sequence: XhXpXp
(φψ)-conformation: bbabaa
Pattern: [FKL][AKV][AV][AEN][RS][AQ][DEY][AE][HL][DEK][PY][ATV]x[EMR]x[AS]
Conservation:-1.452-1.1110.982-0.7690.4750.475-0.2570.560-0.3301.1091.529-0.086-1.111-0.769-0.9401.696
Loops included in this Subclass
LoopPDBChainStartEndSequenceSec StructRamachandran
1e4e_A_1821e4e   A182197KKVNSADELDYAIESAEEE-SGGGHHHHHHHHbxbabaaaaaaaaaaa
1ozh_A_5111ozh   A513528FAVESAEALEPTLRAAEE--SGGGHHHHHHHHbbxabaaaaaaaaaaa
1vi6_A_701vi6   A7287LVAARQYAHKPVQMFSEEE-SGGGHHHHHHHHxbbapaaaaaaaaaaa
PDB ligands within a cut-off distance of 6 Å in this subclass
LoopPDBChainLigandsResidue
1e4e_A_1821e4e   A     GOLGLYCEROL K - 183
1e4e_A_1821e4e   A     GOLGLYCEROL N - 185
1e4e_A_1821e4e   A     GOLGLYCEROL E - 195
1e4e_A_1821e4e   A     GOLGLYCEROL S - 196

Clusters included in this Subclass
CLUSTER: EH.5.151