Logo
Information on SUBCLASS 4.9.2
Subclass Accession number: 1252
Subclass: 4.9.2 PSSM
Type: EH beta-alpha
DB: ArchDB40

Image coordinates: Rasmol PDB Jmol PDB
Consensus coordinates: Rasmol PDB Jmol PDB

Conserved Annotation
EC : 1.2 (>75 %)  1.2.4 (>75 %)  1.2.4.1
GO : GO:0004425 (>75 %)  GO:0004738 (>75 %)  GO:0004739 (>75 %)  GO:0016624 (>75 %)  GO:0016829 (>50 %)  GO:0016830 (>50 %)  GO:0016831 (>75 %)  GO:0016903 (>75 %)  
SCOP : 51366 (>75 %)  51381 (>75 %)  52517 (>75 %)  52518 (>75 %)  53849 (>75 %)  53850 (>75 %)  53851 (>75 %)  
 Number of loops: 2

Average sequence ID (%) : 43.5 +/- 0.0
Average RMSD (Å) : 0.400 +/- 0.000

Consensus geometry
d (Å): 13 delta (°): 45-90 theta (°): 135-180 rho (°): 90-135
Consensus Sequence: GIpXhSXN
(φψ)-conformation: bbpaapaa
Pattern: [G][GV][LW][HS][AI][G][I][NS][AK][AY][S][DP][N][K][AE][L][A][KW][E][F][LV][EK]x
Conservation:1.595-1.475-0.400-0.554-1.1681.5950.367-0.247-1.015-1.0150.367-0.4001.5950.981-1.0150.3670.367-0.5540.9811.595-0.554-0.247-1.168
Loops included in this Subclass
LoopPDBChainStartEndSequenceSec StructRamachandran
1eu8_A_2921eu8   A293315GGWHIGISKYSDNKALAWEFVKFEEEEEEEBTT-S-HHHHHHHHHHbebbbbbxaaxaaaaaaaaaaaa
1hsj_A_2601hsj   A260282GVLSAGINAASPNKELAKEFLENEEEEEEEBSS-S-HHHHHHHHHHbbpbbxxpaapaaaaaaaaaaaa
PDB ligands within a cut-off distance of 6 Å in this subclass
LoopPDBChainLigandsResidue
1eu8_A_2921eu8   A     TRETREHALOSE L - 292
1eu8_A_2921eu8   A     TRETREHALOSE G - 293
1eu8_A_2921eu8   A     TRETREHALOSE G - 294
1eu8_A_2921eu8   A     TRETREHALOSE W - 295
1hsj_A_2601hsj   A     GLCGLUCOSE G - 260
1hsj_A_2601hsj   A     GLCGLUCOSE L - 262

Clusters included in this Subclass
CLUSTER: EH.5.314