Logo
Information on SUBCLASS 12.2.1
Subclass Accession number: 1582
Subclass: 12.2.1 PSSM
Type: EH beta-alpha
DB: ArchDB40

Image coordinates: Rasmol PDB Jmol PDB
Consensus coordinates: Rasmol PDB Jmol PDB

Conserved Annotation
EC : 1.7 (>75 %)  1.7.2 (>75 %)  1.7.2.33.2 (>50 %)  3.2.1 (>50 %)  3.2.1.8
GO : GO:0004553 (>75 %)  GO:0016661 (>75 %)  GO:0016798 (>75 %)  GO:0030151 (>75 %)  GO:0030151 (>75 %)  GO:0046914 (>75 %)  GO:0046914 (>75 %)  
SCOP : 51445 (>75 %)  51487 (>75 %)  53705 (>75 %)  53705 (>75 %)  53706 (>75 %)  53706 (>75 %)  53707 (>75 %)  53707 (>75 %)  
 Number of loops: 3

Average sequence ID (%) : 52.2 +/- 4.4
Average RMSD (Å) : 0.400 +/- 0.100

Consensus geometry
d (Å): 15 delta (°): 45-90 theta (°): 90-135 rho (°): 90-135
Consensus Sequence: VNEhhcpDhphRppXh
(φψ)-conformation: bblabpaalpppapaa
Pattern: [AY][W][D][V][V][N][E][AV][FV][GN][DE][D][GL][KS][LM][R][DNQ][ST]x[FW][LY][KNQ][IV]
Conservation:-0.9173.2351.0260.1420.1421.0260.584-0.696-0.778-0.2760.0761.026-1.201-0.583-0.2110.584-0.693-0.426-1.3800.654-0.515-0.742-0.075
Loops included in this Subclass
LoopPDBChainStartEndSequenceSec StructRamachandran
1hiz_A_1541hiz   A154176YWDVVNEVVGDDGKLRNSPWYQIEEEEEES-B-TTSSB---HHHHHbbxabblabxaavbpxaxaaaaa
1i1w_A_1251i1w   A125147AWDVVNEAFNEDGSLRQTVFLNVEEEEEES-B-TTSSB---HHHHHbbxabblabxaavxxxxxaaaaa
1ur1_A_1511ur1   A151173AWDVVNEAVGDDLKMRDSHWYKIEEEEEE--B-TTSSB---HHHHHbbxabbvabxaavxpxaxaaaaa
PDB ligands within a cut-off distance of 6 Å in this subclass
LoopPDBChainLigandsResidue
1hiz_A_1541hiz   A     GLCGLUCOSE N - 159
1hiz_A_1541hiz   A     GLCGLUCOSE E - 160
1hiz_A_1541hiz   A     GLCGLUCOSE D - 164
1i1w_A_1251i1w   A     GOLGLYCEROL N - 130
1i1w_A_1251i1w   A     GOLGLYCEROL E - 131
1i1w_A_1251i1w   A     EOHETHANOL N - 134
1i1w_A_1251i1w   A     EOHETHANOL G - 137
1i1w_A_1251i1w   A     EOHETHANOL S - 138
1i1w_A_1251i1w   A     EOHETHANOL L - 139
1i1w_A_1251i1w   A     EOHETHANOL R - 140
1i1w_A_1251i1w   A     UNXUNKNOWN ATOM OR ION L - 145
1i1w_A_1251i1w   A     EOHETHANOL L - 145
1ur1_A_1511ur1   A     XYSXYLOPYRANOSE D - 153
1ur1_A_1511ur1   A     XYSXYLOPYRANOSE N - 156
1ur1_A_1511ur1   A     XYSXYLOPYRANOSE E - 157
PDB Site Annotated loops in this subclass
LoopPDBChainSiteResidue
1ur1_A_1511ur1   A ACBCATALYTIC ACID BASEE - 157

Clusters included in this Subclass
CLUSTER: EH.11.13