Logo
Information on SUBCLASS 5.8.4
Subclass Accession number: 3229
Subclass: 5.8.4 PSSM
Type: EH beta-alpha
DB: ArchDB95

Image coordinates: Rasmol PDB Jmol PDB
Consensus coordinates: Rasmol PDB Jmol PDB

Conserved Annotation
EC : - (>75 %)  4.1 (>50 %)  4.1.1 (>50 %)  4.1.1.48
GO : GO:0004425 (>50 %)  GO:0016829 (>50 %)  GO:0016830 (>50 %)  GO:0016831 (>50 %)  
SCOP : 51366 (>50 %)  51381 (>50 %)  
 Number of loops: 3

Average sequence ID (%) : 21.1 +/- 17.4
Average RMSD (Å) : 0.533 +/- 0.231

Consensus geometry
d (Å): 11 delta (°): 45-90 theta (°): 135-180 rho (°): 135-180
Consensus Sequence: hhhphhpXp
(φψ)-conformation: bbaaabpaa
Pattern: [ATV][IKV][L][ILM][IW][ACV][KR][AI][CL][HT]x[ERS][EQ][IL][EKM][ES]x[ILY][ES]
Conservation:-0.672-1.1331.9790.480-0.415-0.4421.606-0.4350.2690.059-0.903-0.7871.6061.039-0.9030.224-1.594-0.4420.462
Loops included in this Subclass
LoopPDBChainStartEndSequenceSec StructRamachandran
1a53_*_1291a53   -129147TVLLIVKILTERELESLLEEEEEEGGGS-HHHHHHHHHbbxbbaaabxaaaaaaaaa
1e5d_A_2831e5d   A284302VKLMWCKACHHSQIMSEISEEEEETTTS-HHHHHHHHHbbxbxaaabxaaaaaaaaa
1i4n_A_1271i4n   A127145AILIIARILTAEQIKEIYEEEEEEGGGS-HHHHHHHHHbbbbxaaabxaaaaaaaaa
PDB ligands within a cut-off distance of 6 Å in this subclass
LoopPDBChainLigandsResidue
1a53_*_1291a53   *     IGPINDOLE-3-GLYCEROL PHOSPHATE L - 131
1a53_*_1291a53   *     IGPINDOLE-3-GLYCEROL PHOSPHATE I - 133

Clusters included in this Subclass
CLUSTER: EH.6.300