Information on SUBCLASS 15.6.1 |
Subclass Accession number: 3609
Subclass: 15.6.1 Type: EH beta-alpha DB: ArchDB95 Image coordinates: Consensus coordinates: Conserved Annotation EC : 2.4 (>75 %) 2.4.1 (>75 %) 2.4.1.194.1 (>75 %) 4.1.2 (>75 %) 4.1.2.13 GO : GO:0004332 (>75 %) GO:0004553 (>50 %) GO:0005509 (>50 %) GO:0016160 (>50 %) GO:0016757 (>50 %) GO:0016798 (>50 %) GO:0016829 (>75 %) GO:0016830 (>75 %) GO:0016832 (>75 %) SCOP : 51445 (>75 %) 51446 (>75 %) 51569 (>75 %) 51570 (>75 %) |
Number of loops: 3 Average sequence ID (%) : 84.9 +/- -57.5 Average RMSD (Å) : 0.233 +/- 0.058 Consensus geometry
|
Consensus Sequence: | LKPNMVThGHACTpKYpXE |
(φψ)-conformation: | bbwpppbppaapappbpaa |
Pattern: | x | x | x | x | x | x | x | x | x | x | x | x | x | x | x | x | x | x | x | x | x | x | x | x | x | x | x | x | x | x | x |
Conservation: | -0.443 | -0.443 | 0.211 | 1.520 | 0.866 | 0.211 | -0.443 | 0.211 | -1.589 | 0.866 | 2.175 | -0.443 | 2.829 | 0.211 | -1.098 | 0.211 | 1.520 | -1.262 | -1.262 | 0.211 | -0.771 | -0.771 | -0.443 | 0.211 | -0.443 | 0.211 | -0.443 | 0.211 | -0.443 | -0.443 | -0.934 |
Loops included in this Subclass |
Loop | PDB | Chain | Start | End | Sequence | Sec Struct | Ramachandran |
1ado_A_227 | 1ado | A | 227 | 257 | LLKPNMVTPGHACTQKYSHEEIAMATVTALR | EE--------TT--S---HHHHHHHHHHHHH | bbbbxxxbwxaaxaxxbxaaaaaaaaaaaaa |
1fdj_A_1227 | 1fdj | A | 1227 | 1257 | LLKPNMVTAGHACTKKYTPEQVAMATVTALH | EE--------TT-S----HHHHHHHHHHHHH | bbbwxxxbxxaaxaxxbxaaaaaaaaaaaaa |
1qo5_B_227 | 1qo5 | B | 227 | 257 | LLKPNMVTAGHACTKKYTPEQVAMATVTALH | EE--------TT------HHHHHHHHHHHHH | bbbwxxxbxxaaxaxbbbaaaaaaaaaaaaa |
PDB ligands within a cut-off distance of 6 Å in this subclass |
Loop | PDB | Chain | Ligands | Residue |
1ado_A_227 | 1ado | A | 13P1,3-DIHYDROXYACETONEPHOSPHATE | K - 229 |
1fdj_A_1227 | 1fdj | A | 2FP1,6-FRUCTOSE DIPHOSPHATE (LINEAR FORM) | K - 1229 |
PDB Site Annotated loops in this subclass |
Clusters included in this Subclass |
CLUSTER: EH.15.18 |