Logo
Information on SUBCLASS 22.1.1
Subclass Accession number: 4334
Subclass: 22.1.1 PSSM
Type: AR beta-beta link
DB: ArchDB95

Image coordinates: Rasmol PDB Jmol PDB
Consensus coordinates: Rasmol PDB Jmol PDB

Conserved Annotation
EC : 3.1 (>75 %)  3.1 (>75 %)  3.1.1 (>75 %)  3.1.1 (>75 %)  3.1.1.73.1.1.7 (>75 %)  
GO : GO:0004091 (>75 %)  GO:0004091 (>75 %)  GO:0004104 (>75 %)  GO:0004104 (>75 %)  GO:0016788 (>75 %)  GO:0016788 (>75 %)  GO:0016789 (>75 %)  GO:0016789 (>75 %)  
SCOP : 53473 (>75 %)  53473 (>75 %)  53474 (>75 %)  53474 (>75 %)  53475 (>75 %)  53475 (>75 %)  
Number of loops: 3

Average sequence ID (%) : 56.2 +/- -1.0
Average RMSD (Å) : 0.267 +/- 0.058

Consensus geometry
d (Å): 13 delta (°): 90-135 theta (°): 90-135 rho (°): 315-360
Consensus Sequence: IPhApPPhGpXRFXXPpXXpXWSchh
(φψ)-conformation: pwabpppbeaaplpppbppppbbebp
Pattern: [GS][HPT][IV][ST][A][F][L][G][I][P][FY][A][EQ][P][P][LV][G][NRS]x[R][F][KMR][KPR][P][EQ][PS][KL][KRT][KP][W][S][DG][IV][LW][DN]
Conservation:-0.550-1.341-0.226-0.599-0.0050.919-0.0050.919-0.0051.3820.325-0.005-0.2251.3821.382-0.6870.919-1.084-1.2380.4570.919-1.084-1.0841.382-0.225-0.700-1.222-1.084-0.6123.231-0.005-0.672-0.232-0.144-0.185
Loops included in this Subclass
LoopPDBChainStartEndSequenceSec StructRamachandran
1ea5_A_251ea5   A2559SHISAFLGIPFAEPPVGNMRFRRPEPKKPWSGVWNEEEEEEEEEE-B----GGGTTS---B----SSEEEbbbxbbbvxwabxpxbeaapvxxxbpxxpbxebxx
1n5m_A_271n5m   A2761GPVSAFLGIPFAEPPVGSRRFMPPEPKRPWSGVLDEEEEEEEEEE-B----GGGTTS---B----SSEEEexbxbbbvxwabxpabeaapvxpxbpxxpbbexxx
1p0i_A_231p0i   A2357GTVTAFLGIPYAQPPLGRLRFKKPQSLTKWSDIWNEEEEEEEEEE-S----GGGTTS---------SEEEbbbbbbbvxxabxpxbeaaxvxxwbxxxpbbebxx
PDB ligands within a cut-off distance of 6 Å in this subclass
LoopPDBChainLigandsResidue
1ea5_A_251ea5   A     NAGN-ACETYL-D-GLUCOSAMINE N - 59
1n5m_A_271n5m   A     IODIODIDE ION G - 27
1n5m_A_271n5m   A     IODIODIDE ION P - 28
1p0i_A_231p0i   A     GOLGLYCEROL A - 27
1p0i_A_231p0i   A     GOLGLYCEROL L - 29
1p0i_A_231p0i   A     NAGN-ACETYL-D-GLUCOSAMINE D - 54
1p0i_A_231p0i   A     NAGN-ACETYL-D-GLUCOSAMINE I - 55
1p0i_A_231p0i   A     NAGN-ACETYL-D-GLUCOSAMINE W - 56
1p0i_A_231p0i   A     NAGN-ACETYL-D-GLUCOSAMINE N - 57

Clusters included in this Subclass
CLUSTER: AR.22.1