ArchDB - Biological DataBase of Protein Loops

Information on SUBCLASS 24.3.1

Subclass Accession number: 4339
Subclass: 24.3.1

Type: AR beta-beta link
DB: ArchDB95

Image coordinates:

Consensus coordinates:

Conserved Annotation
EC : 3.5 (>75 %)  3.5.1 (>75 %)  3.5.1.1
GO : GO:0004067 (>75 %)  GO:0016810 (>75 %)  GO:0016811 (>75 %)
SCOP : 53773 (>75 %)  53774 (>75 %)  53775 (>75 %)

Number of loops: 3

Average sequence ID (%) : 42.4 +/- 11.6
Average RMSD (Å) : 0.567 +/- 0.115

Consensus geometry

d (Å): 31

delta (°): 45-90

theta (°): 45-90

rho (°): 315-360

Consensus Sequence:	phXpXhXpXHTXppXFDhpXhppLPpVc
(φψ)-conformation:	bbabbpappbeaapapbaaababbppbb

Pattern:	[KR]	x	[DY]	[WY]	[FQ]	[NR]	x	[IP]	[AD]	[KR]	x	[H]	[T]	[STV]	[DNR]	[ST]	x	[F]	[D]	[IV]	[KRS]	[GKQ]	[IL]	[NST]	[ES]	[L]	[P]	[KQ]	[V]	[DG]	[I]	[ALV]	[Y]
Conservation:	0.232	-0.994	-0.506	1.057	-0.893	-0.169	-1.235	-0.638	-0.835	0.229	-1.011	2.449	0.942	-0.956	-0.732	-0.199	-1.235	1.444	1.444	0.201	-0.677	-1.011	-0.038	-0.509	-0.437	0.440	1.946	-0.014	0.440	-0.220	0.440	-0.900	1.946

Loops included in this Subclass

Loop	PDB	Chain	Start	End	Sequence	Sec Struct	Ramachandran
1nns_A_186	1nns	A	186	218	KIDYQRTPARKHTSDTPFDVSKLNELPKVGIVY	EEEE-----S--GGGS----TT-S----EEEEE	bbxxabbxaxxbeaabaxbaaaxabbpxbbbbb
1o7j_A_192	1o7j	A	192	224	RIYYQNRIDKLHTTRSVFDVRGLTSLPKVDILY	EEEE----SS--GGG-----TT-S----EEEEE	bxbxabbxabxbeaaxaxbaaababbpxbbbbx
4pga_A_196	4pga	A	196	228	KSYWFRLPAKRHTVNSEFDIKQISSLPQVDIAY	EEEE-----S--GGG-S--GGG-S----EEEEE	bxbbabbwaxxbeaaxabbaaababbxxbbbbx

PDB ligands within a cut-off distance of 6 Å in this subclass

PDB Site Annotated loops in this subclass

Loop	PDB	Chain	Site	Residue
1o7j_A_192	1o7j	A	AC3GOL BINDING SITE FOR CHAIN A	S - 216
1o7j_A_192	1o7j	A	AC3GOL BINDING SITE FOR CHAIN A	L - 217
1o7j_A_192	1o7j	A	AC3GOL BINDING SITE FOR CHAIN A	K - 219

Clusters included in this Subclass