Information on SUBCLASS 26.2.1 |
Subclass Accession number: 4342
Subclass: 26.2.1 Type: AR beta-beta link DB: ArchDB95 Image coordinates: Consensus coordinates: Conserved Annotation EC : 3.4 (>75 %) 3.4.21 (>75 %) 3.4.21 (>75 %) GO : GO:0004175 (>75 %) GO:0004252 (>75 %) GO:0004252 (>75 %) GO:0008233 (>75 %) GO:0008236 (>75 %) GO:0008236 (>75 %) SCOP : 50493 (>75 %) 50493 (>75 %) 50494 (>75 %) 50494 (>75 %) 50514 (>75 %) 50514 (>75 %) |
Number of loops: 3 Average sequence ID (%) : 47.7 +/- 7.2 Average RMSD (Å) : 0.833 +/- 0.289 Consensus geometry
|
Consensus Sequence: | pLpEKAphXXhVXXLXhXpXXpXVXPGphC |
(φψ)-conformation: | ppabppppbaabbpbpppabpbppppgppb |
Pattern: | [KLM] | [L] | [L] | [KQ] | [L] | [KST] | [E] | [K] | [A] | [KST] | [IL] | [GNT] | x | [AY] | [V] | [GRT] | [IPT] | [L] | [HP] | [FLW] | [PQ] | [KRS] | x | x | [DNR] | x | [V] | x | [P] | [G] | [RT] | [LM] | [C] | [DQR] | [V] | [A] | [G] |
Conservation: | -0.861 | 0.496 | 0.496 | 0.032 | 0.496 | -0.748 | 1.004 | 1.004 | 0.496 | -0.748 | 0.009 | -0.804 | -1.313 | -0.725 | 0.496 | -1.200 | -1.200 | 0.496 | -0.087 | -0.465 | -0.070 | -0.635 | -1.087 | -1.313 | -0.691 | -0.675 | 0.496 | -0.974 | 2.022 | 1.513 | -0.454 | 0.201 | 3.039 | -0.748 | 0.496 | 0.496 | 1.513 |
Loops included in this Subclass |
Loop | PDB | Chain | Start | End | Sequence | Sec Struct | Ramachandran |
1bio_*_104 | 1bio | - | 104 | 140 | LLLQLSEKATLGPAVRPLPWQRVDRDVAPGTLCDVAG | EEEEESS----BTTB----B--S-----TT-EEEEEE | bbbxxabxxxxbaabbxbwbxaxxbpxxpvpxbbbbe |
1nn6_A_106 | 1nn6 | A | 106 | 142 | MLLKLKEKASLTLAVGTLPFPSQFNFVPPGRMCRVAG | EEEEESS-----SS-------S------TT-EEEEEE | bbbxxabxxxxbaabbxbxxxabbbxxxpgxxbbbbb |
1orf_A_104 | 1orf | A | 104 | 140 | KLLQLTEKAKINKYVTILHLPKKGDDVKPGTMCQVAG | EEEEESS----SSSS------SS-----TT-EEEEEE | bxbxxabxpxxbaabbxxxxxabaxpbxpgpxbbbbe |
PDB ligands within a cut-off distance of 6 Å in this subclass |
Loop | PDB | Chain | Ligands | Residue |
1bio_*_104 | 1bio | * | GOLGLYCEROL | D - 129 |
1bio_*_104 | 1bio | * | GOLGLYCEROL | V - 130 |
1bio_*_104 | 1bio | * | GOLGLYCEROL | A - 131 |
1bio_*_104 | 1bio | * | GOLGLYCEROL | P - 132 |
Clusters included in this Subclass |
CLUSTER: AR.26.2 |