Information on SUBCLASS 1.1.62 |
Subclass Accession number: 4409
Subclass: 1.1.62 Type: HH alpha-alpha DB: ArchDB95 Image coordinates: Consensus coordinates: Conserved Annotation EC : 2.3 (>75 %) 2.3.3 (>75 %) 2.3.3.1 GO : GO:0004108 (>75 %) GO:0016746 (>75 %) GO:0046912 (>75 %) SCOP : 48255 (>75 %) 48256 (>75 %) 48257 (>75 %) |
Number of loops: 2 Average sequence ID (%) : 97.3 +/- 0.0 Average RMSD (Å) : 0.100 +/- 0.000 Consensus geometry
|
Consensus Sequence: | PXDPM |
(φψ)-conformation: | aapaa |
Pattern: | [P] | [R] | [Y] | [T] | [C] | [Q] | [R] | [E] | [F] | [A] | [L] | [K] | [H] | [L] | [P] | [GS] | [D] | [P] | [M] | [F] | [K] | [L] | [V] | [A] | [Q] | [L] | [Y] | [K] | [I] | [V] | [P] | [N] | [V] | [L] | [L] | [E] | [Q] |
Conservation: | 1.276 | -0.166 | 1.276 | -0.166 | 2.717 | -0.166 | -0.166 | -0.166 | 0.555 | -0.886 | -0.886 | -0.166 | 1.997 | -0.886 | 1.276 | -1.967 | 0.555 | 1.276 | -0.166 | 0.555 | -0.166 | -0.886 | -0.886 | -0.886 | -0.166 | -0.886 | 1.276 | -0.166 | -0.886 | -0.886 | 1.276 | 0.555 | -0.886 | -0.886 | -0.886 | -0.166 | -0.166 |
Loops included in this Subclass |
Loop | PDB | Chain | Start | End | Sequence | Sec Struct | Ramachandran |
1csc_*_328 | 1csc | - | 328 | 364 | PRYTCQREFALKHLPGDPMFKLVAQLYKIVPNVLLEQ | HHHHHHHHHHHHH-TT-HHHHHHHHHHHHHHHHHHHH | aaaaaaaaaaaaaaaaxaaaaaaaaaaaaaaaaaaaa |
1csh_*_328 | 1csh | - | 328 | 364 | PRYTCQREFALKHLPSDPMFKLVAQLYKIVPNVLLEQ | HHHHHHHHHHHHH-TT-HHHHHHHHHHHHHHHHHHHH | aaaaaaaaaaaaaaaaxaaaaaaaaaaaaaaaaaaaa |
PDB ligands within a cut-off distance of 6 Å in this subclass |
Loop | PDB | Chain | Ligands | Residue |
1csc_*_328 | 1csc | * | CMCCARBOXYMETHYL COENZYME *A | R - 329 |
1csc_*_328 | 1csc | * | MALMALTOSE | R - 329 |
1csc_*_328 | 1csc | * | CMCCARBOXYMETHYL COENZYME *A | L - 361 |
1csc_*_328 | 1csc | * | CMCCARBOXYMETHYL COENZYME *A | Q - 364 |
1csh_*_328 | 1csh | * | AMXAMIDOCARBOXYMETHYLDETHIA COENZYME *A | R - 329 |
1csh_*_328 | 1csh | * | OAAOXALOACETATE ION | R - 329 |
1csh_*_328 | 1csh | * | AMXAMIDOCARBOXYMETHYLDETHIA COENZYME *A | L - 361 |
1csh_*_328 | 1csh | * | AMXAMIDOCARBOXYMETHYLDETHIA COENZYME *A | Q - 364 |
Clusters included in this Subclass |
CLUSTER: HH.5.369 |