Information on SUBCLASS 2.1.40 |
Subclass Accession number: 4540
Subclass: 2.1.40 Type: HH alpha-alpha DB: ArchDB95 Image coordinates: Consensus coordinates: |
Number of loops: 3 Average sequence ID (%) : 70.4 +/- -21.5 Average RMSD (Å) : 0.267 +/- 0.058 Consensus geometry
|
Consensus Sequence: | XTGSEp |
(φψ)-conformation: | aappaa |
Pattern: | x | x | x | x | x | x | x | x | x | x | x | x | x | x | x | x | x | x | x | x | x | x | x | x | x | x | x | x | x | x | x | x | x | x | x | x |
Conservation: | -1.038 | 0.355 | 0.862 | 2.382 | -0.658 | -0.658 | -0.151 | -0.151 | -0.911 | -1.545 | -0.151 | -1.291 | 1.369 | -1.671 | -0.911 | -0.911 | 0.355 | 0.862 | -0.151 | 0.355 | -0.785 | -0.151 | -0.405 | -0.151 | -0.151 | 1.369 | 0.862 | 0.355 | -0.405 | -0.531 | -0.151 | -0.658 | 0.609 | 2.382 | -0.405 | 1.875 |
Loops included in this Subclass |
Loop | PDB | Chain | Start | End | Sequence | Sec Struct | Ramachandran |
1ed1_A_54 | 1ed1 | A | 54 | 89 | KEGCQKILSVLAPLVPTGSENLKSLYNTVCVIWCIH | HHHHHHHHHHHGGGGGG--HHHHHHHHHHHHHHHHH | aaaaaaaaaaaaaaaaaxxaaaaaaaaaaaaaaaaa |
1hiw_A_54 | 1hiw | A | 54 | 89 | SEGCRQILGQLQPSLQTGSEELRSLYNTIAVLYCVH | HHHHHHHHHHHGGGGTT--HHHHHHHHHHHHHHHHH | aaaaaaaaaaaaaaaaaxxaaaaaaaaaaaaaaaaa |
1hiw_S_54 | 1hiw | S | 54 | 89 | SEGCRQILGQLQPSLQTGSEELRSLYNTIAVLYCVH | HHHHHHHHHHHGGGSTT--HHHHHHHHHHHHHHHHH | aaaaaaaaaaaaaaaaaxxaaaaaaaaaaaaaaaaa |
PDB ligands within a cut-off distance of 6 Å in this subclass |
Loop | PDB | Chain | Ligands | Residue |
1ed1_A_54 | 1ed1 | A | IPAISOPROPYL ALCOHOL | P - 66 |
1ed1_A_54 | 1ed1 | A | IPAISOPROPYL ALCOHOL | L - 67 |
1ed1_A_54 | 1ed1 | A | IPAISOPROPYL ALCOHOL | V - 68 |
1ed1_A_54 | 1ed1 | A | IPAISOPROPYL ALCOHOL | T - 70 |
1ed1_A_54 | 1ed1 | A | IPAISOPROPYL ALCOHOL | G - 71 |
1ed1_A_54 | 1ed1 | A | IPAISOPROPYL ALCOHOL | S - 72 |
1ed1_A_54 | 1ed1 | A | IPAISOPROPYL ALCOHOL | L - 75 |
Clusters included in this Subclass |
CLUSTER: HH.7.97 |
CLUSTER: HH.8.57 |