ArchDB - Biological DataBase of Protein Loops

Information on SUBCLASS 9.2.1

Subclass Accession number: 456
Subclass: 9.2.1

Type: HE alpha-beta
DB: ArchDB40

Image coordinates:

Consensus coordinates:

Conserved Annotation
EC : 3.1 (>75 %)  3.1.1 (>75 %)  3.2 (>75 %)  3.2 (>75 %)  3.2.1 (>75 %)  3.2.1 (>75 %)  3.2.1.113 (>75 %)  3.2.1.113
GO : GO:0004091 (>75 %)  GO:0004553 (>75 %)  GO:0004553 (>75 %)  GO:0005509 (>75 %)  GO:0005509 (>75 %)  GO:0015923 (>75 %)  GO:0015923 (>75 %)  GO:0016788 (>75 %)  GO:0016789 (>75 %)  GO:0016798 (>75 %)  GO:0016798 (>75 %)
SCOP : 48207 (>75 %)  48207 (>75 %)  48225 (>75 %)  48225 (>75 %)  48226 (>75 %)  48226 (>75 %)  53473 (>75 %)  53474 (>75 %)  53475 (>75 %)

Number of loops: 3

Average sequence ID (%) : 37.8 +/- 14.8
Average RMSD (Å) : 0.433 +/- 0.208

Consensus geometry

d (Å): 11

delta (°): 45-90

theta (°): 90-135

rho (°): 315-360

Consensus Sequence:	AFpTPSchPhXXh
(φψ)-conformation:	aapbaagpppabb

Pattern:	[DES]	[GIL]	[FL]	x	[DKR]	[KQ]	[AS]	x	[DEN]	[FL]	[AG]	[DNV]	x	[L]	[KLM]	[FP]	[A]	[F]	[DHR]	[T]	[P]	[S]	[GK]	[IV]	[P]	[WY]	[ANS]	x	[ILV]	[N]
Conservation:	-0.397	-1.372	-0.024	-0.796	-0.684	0.110	-0.160	-1.257	-0.168	-0.244	-0.024	-1.143	-1.028	0.577	-0.799	-0.658	0.577	1.609	-0.741	1.093	2.125	0.577	-0.388	0.331	2.125	1.205	-0.684	-1.257	-0.111	1.609

Loops included in this Subclass

Loop	PDB	Chain	Start	End	Sequence	Sec Struct	Ramachandran
1fo3_A_349	1fo3	A	349	378	SLFLRKAEDFGNRLMPAFRTPSKIPYSDVN	HHHHHHHHHHHHHHGGGG-SSS----SEEE	aaaaaaaaaaaaaaaaaaxbaavxxxabbx
1kre_A_149	1kre	A	153	182	DGLLDQSRNLADVLKFAFDTPSGVPYNNIN	HHHHHHHHHHHHHHGGGG-SSSS---SEEE	aaaaaaaaaaaaaaaaaaxbaagxxxabbb
1nxc_A_301	1nxc	A	301	330	EIFRKKAVELGVKLLPAFHTPSGIPWALLN	HHHHHHHHHHHHHHGGGG-SSSS---SEEE	aaaaaaaaaaaaaaawaaxbaavxxxabbx

PDB ligands within a cut-off distance of 6 Å in this subclass

Loop	PDB	Chain	Ligands	Residue
1kre_A_149	1kre	A	NAGN-ACETYL-D-GLUCOSAMINE	N - 182

Clusters included in this Subclass