Information on SUBCLASS 4.9.6 |
Subclass Accession number: 4805
Subclass: 4.9.6 Type: HH alpha-alpha DB: ArchDB95 Image coordinates: Consensus coordinates: Conserved Annotation EC : 1.14 (>75 %) 1.14.16 (>75 %) GO : GO:0004497 (>75 %) GO:0005506 (>75 %) GO:0016597 (>50 %) GO:0016705 (>75 %) GO:0016714 (>75 %) GO:0043176 (>50 %) GO:0046914 (>75 %) SCOP : 56533 (>75 %) 56534 (>75 %) 56535 (>75 %) |
Number of loops: 3 Average sequence ID (%) : 73.3 +/- -30.9 Average RMSD (Å) : 0.233 +/- 0.058 Consensus geometry
|
Consensus Sequence: | ASLGAXpE |
(φψ)-conformation: | aaplppaa |
Pattern: | [PR] | [ST] | [F] | [A] | [Q] | [F] | [S] | [Q] | [DE] | [I] | [G] | [L] | [A] | [S] | [L] | [G] | [A] | [PS] | [DE] | [E] | x | [IV] | [EQ] | [K] | [L] | [AS] | [T] | [CIV] | [Y] | [FW] |
Conservation: | -1.547 | -0.998 | 1.334 | -0.086 | 0.624 | 1.334 | -0.086 | 0.624 | -0.288 | -0.086 | 1.334 | -0.086 | -0.086 | -0.086 | -0.086 | 1.334 | -0.086 | -1.434 | -0.219 | 0.624 | -2.452 | -0.437 | -0.431 | 0.624 | -0.086 | -1.135 | 0.624 | -1.426 | 2.044 | 0.636 |
Loops included in this Subclass |
Loop | PDB | Chain | Start | End | Sequence | Sec Struct | Ramachandran |
1j8u_A_297 | 1j8u | A | 297 | 326 | RSFAQFSQEIGLASLGAPDEYIEKLATIYW | HHHHHHHHHHHHHHTT--HHHHHHHHHHHH | aaaaaaaaaaaaaaxvxxaaaaaaaaaaaa |
1mlw_A_284 | 1mlw | A | 284 | 313 | PSFAQFSQEIGLASLGASEEAVQKLATCYF | HHHHHHHHHHHHHHTT--HHHHHHHHHHHH | aaaaaaaaaaaaaaxvxxaaaaaaaaaaaa |
1toh_*_343 | 1toh | - | 343 | 372 | RTFAQFSQDIGLASLGASDEEIEKLSTVYW | HHHHHHHHHHHHHHTT--HHHHHHHHHHHH | aaaaaaaaaaaaaapvxxaaaaaaaaaaaa |
PDB ligands within a cut-off distance of 6 Å in this subclass |
Loop | PDB | Chain | Ligands | Residue |
1j8u_A_297 | 1j8u | A | THBTETRAHYDROBIOPTERIN | L - 321 |
1j8u_A_297 | 1j8u | A | THBTETRAHYDROBIOPTERIN | A - 322 |
1j8u_A_297 | 1j8u | A | FE2FE (II) ION | Y - 325 |
1j8u_A_297 | 1j8u | A | THBTETRAHYDROBIOPTERIN | Y - 325 |
1j8u_A_297 | 1j8u | A | THBTETRAHYDROBIOPTERIN | W - 326 |
1mlw_A_284 | 1mlw | A | HBL7,8-DIHYDRO-L-BIOPTERIN | A - 309 |
1mlw_A_284 | 1mlw | A | FEFE (III) ION | Y - 312 |
1mlw_A_284 | 1mlw | A | HBL7,8-DIHYDRO-L-BIOPTERIN | Y - 312 |
1mlw_A_284 | 1mlw | A | HBL7,8-DIHYDRO-L-BIOPTERIN | F - 313 |
1toh_*_343 | 1toh | * | FEFE (III) ION | Y - 371 |
Clusters included in this Subclass |
CLUSTER: HH.3.324 |