Information on SUBCLASS 5.3.6 |
Subclass Accession number: 4883
Subclass: 5.3.6 Type: HH alpha-alpha DB: ArchDB95 Image coordinates: Consensus coordinates: |
Number of loops: 3 Average sequence ID (%) : 14.9 +/- 14.4 Average RMSD (Å) : 0.967 +/- 0.289 Consensus geometry
|
Consensus Sequence: | hhppphpph |
(φψ)-conformation: | aapaappaa |
Pattern: | [PQ] | x | x | [KR] | [DK] | x | [AFL] | [DNR] | x | [AL] | [LVY] | [DR] | x | [AIV] | [FGI] | [DS] | [KST] | [DET] | [AL] | [DST] | [QY] | [AG] | [E] | x | x | [ASV] | x | [FIT] | [A] | [AR] | [LTV] | [EHY] | x | [IVW] | [AFL] | x | [QS] | [AGL] |
Conservation: | 1.356 | -0.991 | -0.789 | 1.816 | 0.937 | -0.587 | -0.688 | 0.020 | -1.194 | 0.063 | -0.183 | 0.277 | -0.486 | 0.121 | -1.295 | 1.317 | -0.081 | 0.121 | 0.063 | 0.020 | 0.784 | 0.707 | 3.053 | -0.991 | -0.587 | -0.486 | -1.295 | -0.587 | 2.143 | 0.443 | -0.183 | 0.525 | -0.688 | -0.183 | -0.688 | -1.295 | 0.603 | -1.093 |
Loops included in this Subclass |
Loop | PDB | Chain | Start | End | Sequence | Sec Struct | Ramachandran |
1h0o_A_202 | 1h0o | A | 202 | 239 | PCVKKKADWALRWIGDKEATYGERVVAFAAVEGIFFSG | HHHHHHHHHHHHHHH-SSS-HHHHHHHHHHHHHHHHHH | aaaaaaaaaaaaaaaxaapxaaaaaaaaaaaaaaaaaa |
1nh1_A_223 | 1nh1 | A | 224 | 261 | PIIKDHLNDLYRQAISSDLSQAELISLIARTHWWAASA | HHHHHHHHHHHHHHT-SS--HHHHHHHHHHHHHHHHHH | aaaaaaaaaaaaaaaxaaxxaaaaaaaaaaaaaaaaaa |
1odo_A_161 | 1odo | A | 161 | 198 | QDRRDGFRALVDGVFDTTLDQAEAQANTARLYEVLDQL | HHHHHHHHHHHHHHH-TT--HHHHHHHHHHHHHHHHHH | aaaaaaaaaaaaaaaxaaxxaaaaaaaaaaaaaaaaaa |
PDB ligands within a cut-off distance of 6 Å in this subclass |
Loop | PDB | Chain | Ligands | Residue |
1h0o_A_202 | 1h0o | A | COCOBALT (II) ION | E - 233 |
1h0o_A_202 | 1h0o | A | COCOBALT (II) ION | F - 237 |
1odo_A_161 | 1odo | A | PIM4-PHENYL-1H-IMIDAZOLE | V - 174 |
1odo_A_161 | 1odo | A | PIM4-PHENYL-1H-IMIDAZOLE | F - 175 |
PDB Site Annotated loops in this subclass |
Loop | PDB | Chain | Site | Residue |
1h0o_A_202 | 1h0o | A | CO1CO BINDING SITE FOR CHAIN A | E - 233 |
Clusters included in this Subclass |
CLUSTER: HH.5.198 |