Information on SUBCLASS 9.2.2 |
Subclass Accession number: 5068
Subclass: 9.2.2 Type: HH alpha-alpha DB: ArchDB95 Image coordinates: Consensus coordinates: Conserved Annotation GO : GO:0004175 (>75 %) GO:0004197 (>75 %) GO:0005509 (>75 %) GO:0008233 (>75 %) GO:0008234 (>75 %) SCOP : 47472 (>75 %) 47473 (>75 %) 63550 (>75 %) |
Number of loops: 4 Average sequence ID (%) : 52.8 +/- 28.6 Average RMSD (Å) : 1.000 +/- 0.245 Consensus geometry
|
Consensus Sequence: | XhDpDppGphGXp |
(φψ)-conformation: | aapaalalbbpaa |
Pattern: | [I] | [DK] | [KRT] | [CW] | [QR] | [AGS] | [IM] | [VY] | [AK] | [qr] | [FM] | [D] | [STV] | [D] | [RT] | [ST] | [G] | [KT] | [IL] | [CG] | [s] | [ENS] | [E] | [FL] | [KP] | [GY] | [AL] | [FW] | [EN] | [AN] |
Conservation: | 0.824 | -0.394 | -0.760 | 0.924 | 0.147 | -0.710 | -0.059 | -0.266 | -0.677 | -1.439 | 0.011 | 2.201 | -1.027 | 2.201 | -0.536 | -0.059 | 2.201 | -0.536 | 0.141 | -0.330 | -0.942 | -0.639 | 1.512 | -0.259 | -0.124 | -0.730 | -0.883 | 1.202 | -0.053 | -0.942 |
Loops included in this Subclass |
Loop | PDB | Chain | Start | End | Sequence | Sec Struct | Ramachandran |
1alv_A_159 | 1alv | A | 169 | 198 | IKKWQAIYKQFDVDRSGTIGSSELPGAFEA | HHHHHHHHHHH-TT--SSB-TTTHHHHHHH | aaaaaaaaaaaxaalavbbxaaaaaaaaaa |
1kfu_S_841 | 1kfu | S | 841 | 870 | IDTCRSMVAVMDSDTTGKLGFEEFKYLWNN | HHHHHHHHHHH-SS--S-B-SHHHHHHHHH | aaaaaaaaaaaxaavavbxxaaaaaaaaaa |
1kfu_S_862 | 1kfu | S | 871 | 900 | IKRWQAIYKQFDTDRSGTICSSELPGAFEA | HHHHHHHHHHS-TT-SSSB-GGGHHHHHHH | aaaaaaaaaaabaalavbbpaaaaaaaaaa |
1np8_A_77 | 1np8 | A | 87 | 116 | IKKWQGIYKRFDTDRSGTIGSNELPGAFEA | HHHHHHHHHHH-TT-SSSB-TTTHHHHHHH | aaaaaaaaaaaxaalavbbbaaaaaaaaaa |
PDB ligands within a cut-off distance of 6 Å in this subclass |
Clusters included in this Subclass |
CLUSTER: HH.11.66 |
CLUSTER: HH.12.28 |