Information on SUBCLASS 9.16.1 |
Subclass Accession number: 5084
Subclass: 9.16.1 Type: HH alpha-alpha DB: ArchDB95 Image coordinates: Consensus coordinates: Conserved Annotation EC : 2.3 (>75 %) 2.3.3 (>75 %) 2.3.3.12.7.7 (>75 %) 2.7.7.3 GO : GO:0004108 (>75 %) GO:0004595 (>50 %) GO:0016746 (>75 %) GO:0016779 (>50 %) GO:0046912 (>75 %) SCOP : 48255 (>75 %) 48256 (>75 %) 48257 (>75 %) 52373 (>75 %) 52374 (>75 %) 52397 (>75 %) |
Number of loops: 3 Average sequence ID (%) : 96.7 +/- -91.8 Average RMSD (Å) : 0.133 +/- 0.058 Consensus geometry
|
Consensus Sequence: | EQGXAXNPWPNVD |
(φψ)-conformation: | aalapabappbaa |
Pattern: | x | x | x | x | x | x | x | x | x | x | x | x | x | x | x | x | x | x | x | x | x | x | x | x | x | x | x | x | x | x | x | x | x | x | x | x | x | x | x | x |
Conservation: | 1.097 | -0.081 | 0.508 | -0.081 | -0.670 | -0.670 | -0.670 | -0.081 | -0.670 | 1.097 | -0.081 | -0.670 | -0.670 | 1.097 | 0.508 | -0.670 | -0.670 | -0.670 | -0.081 | -0.081 | 0.508 | -1.996 | -0.670 | -1.996 | 0.508 | 1.097 | 3.454 | 1.097 | 0.508 | -0.670 | 0.508 | -0.670 | 1.686 | -0.670 | 0.508 | -0.670 | -0.670 | -0.670 | -0.081 | 1.097 |
Loops included in this Subclass |
Loop | PDB | Chain | Start | End | Sequence | Sec Struct | Ramachandran |
1csc_*_345 | 1csc | - | 345 | 384 | PMFKLVAQLYKIVPNVLLEQGAAANPWPNVDAHSGVLLQY | HHHHHHHHHHHHHHHHHHHHT--S--SB-THHHHHHHHHH | aaaaaaaaaaaaaaaaaaaavaxabaxxbaaaaaaaaaaa |
1csh_*_345 | 1csh | - | 345 | 384 | PMFKLVAQLYKIVPNVLLEQGKAKNPWPNVDAHSGVLLQY | HHHHHHHHHHHHHHHHHHHHT--S--SB-THHHHHHHHHH | aaaaaaaaaaaaaaaaaaaavaxabaxxbaaaaaaaaaaa |
2cts_*_345 | 2cts | - | 345 | 384 | PMFKLVAQLYKIVPNVLLEQGKAKNPWPNVDAHSGVLLQY | HHHHHHHHHHHHHHHHHHHTT--S--SB-THHHHHHHHHH | aaaaaaaaaaaaaaaaaaaavaxabaxxbaaaaaaaaaaa |
PDB ligands within a cut-off distance of 6 Å in this subclass |
Clusters included in this Subclass |
CLUSTER: HH.10.77 |