Information on SUBCLASS 9.21.1 |
Subclass Accession number: 5089
Subclass: 9.21.1 Type: HH alpha-alpha DB: ArchDB95 Image coordinates: Consensus coordinates: Conserved Annotation EC : 5.3 (>50 %) 5.3.1 (>50 %) 5.3.1.5 GO : GO:0005083 (>75 %) GO:0005085 (>75 %) GO:0005086 (>75 %) GO:0030695 (>75 %) SCOP : 48370 (>75 %) 48425 (>75 %) 48426 (>75 %) 51658 (>50 %) 51665 (>50 %) |
Number of loops: 3 Average sequence ID (%) : 61.9 +/- -8.3 Average RMSD (Å) : 0.567 +/- 0.208 Consensus geometry
|
Consensus Sequence: | XHNPpVpppMXhp |
(φψ)-conformation: | aapaapabpppaa |
Pattern: | [AT] | [D] | [ST] | [CV] | [FY] | [IV] | [L] | [S] | [Y] | [S] | [IV] | [I] | [M] | [L] | [N] | [T] | [D] | x | [H] | [N] | [P] | [NQ] | [V] | [KR] | [DE] | [HK] | [M] | [GST] | [FL] | [DE] | [DR] | [FY] | [SV] | [AGN] | x |
Conservation: | -0.954 | 1.178 | -0.673 | -0.758 | 0.456 | -0.222 | 0.049 | 0.049 | 1.742 | 0.049 | -0.232 | 0.049 | 0.613 | 0.049 | 1.178 | 0.613 | 1.178 | -1.576 | 2.307 | 1.178 | 1.742 | -0.670 | 0.049 | -0.228 | 0.004 | -0.574 | 0.613 | -1.394 | -0.743 | -0.109 | -1.185 | 0.501 | -1.634 | -1.457 | -1.185 |
Loops included in this Subclass |
Loop | PDB | Chain | Start | End | Sequence | Sec Struct | Ramachandran |
1ku1_A_695 | 1ku1 | A | 695 | 729 | ADSVFILSYSIIMLNTDLHNPQVKEHMSFEDYSGN | HHHHHHHHHHHHHHHHHHT-TT-SS---HHHHHHH | aaaaaaaaaaaaaaaaaaabaaxabppxaaaaaaa |
1r8s_E_182 | 1r8s | E | 182 | 216 | TDTCYVLSYSVIMLNTDLHNPNVRDKMGLERFVAM | HHHHHHHHHHHHHHHHHHH-TT--S---HHHHHHH | aaaaaaaaaaaaaaaaaaaxaaxabpxxaaaaaaa |
1re0_B_248 | 1re0 | B | 248 | 282 | ADSVFVLSYSIIMLNTDSHNPQVKDHMTFDDYSNN | HHHHHHHHHHHHHHHHHHH-TT--S---HHHHHHH | aaaaaaaaaaaaaaaaaaaxaaxabxxxaaaaaaa |
PDB ligands within a cut-off distance of 6 Å in this subclass |
Clusters included in this Subclass |
CLUSTER: HH.9.78 |