ArchDB - Biological DataBase of Protein Loops

Information on SUBCLASS 18.1.1

Subclass Accession number: 5173
Subclass: 18.1.1

Type: HH alpha-alpha
DB: ArchDB95

Image coordinates:

Consensus coordinates:

Conserved Annotation
EC : 1.11 (>75 %)  1.11.1 (>75 %)  1.11.1.7 2.1 (>75 %)  2.1.1 (>75 %)  2.1.1.45
GO : GO:0004601 (>75 %)  GO:0008168 (>75 %)  GO:0016684 (>75 %)  GO:0016741 (>75 %)  GO:0042083 (>75 %)
SCOP : 48112 (>75 %)  48113 (>75 %)  48114 (>75 %)  55830 (>75 %)  55831 (>75 %)  55832 (>75 %)

Number of loops: 3

Average sequence ID (%) : 59.6 +/- -6.9
Average RMSD (Å) : 0.333 +/- 0.058

Consensus geometry

d (Å): 31

delta (°): 135-180

theta (°): 0-45

rho (°): 180-225

Consensus Sequence:	LXGGPXWpVhLGRpDXLXAXXX
(φψ)-conformation:	aagppbbpppbgpbppabbbaa

Pattern:	[C]	[AS]	[D]	[ILV]	[L]	[AT]	[IL]	[A]	[AS]	[EQR]	[ADQ]	[S]	[V]	[STV]	[L]	[AS]	[G]	[G]	[P]	[GS]	[W]	[RT]	[V]	[ALP]	[L]	[G]	[R]	[KR]	[D]	[GS]	[L]	x	[A]	x	x	[ADN]	x	[A]
Conservation:	2.325	-0.477	1.023	-0.423	0.155	-0.539	-0.263	0.155	-0.477	-0.568	-1.147	0.155	0.155	-1.050	0.155	-0.479	1.023	1.023	1.457	-0.537	3.193	-0.675	0.155	-1.340	0.155	1.023	0.589	-0.045	1.023	-0.537	0.155	-1.195	0.155	-0.860	-1.037	-1.099	-1.484	0.155

Loops included in this Subclass

Loop	PDB	Chain	Start	End	Sequence	Sec Struct	Ramachandran
1gwu_A_97	1gwu	A	97	134	CADLLTIAAQQSVTLAGGPSWRVPLGRRDSLQAFLDLA	HHHHHHHHHHHHHHHTT-------B--BB-SS--HHHH	aaaaaaaaaaaaaaaagxxbbxxxbgxbxxabbbaaaa
1pa2_A_97	1pa2	A	97	134	CSDVLALASEASVSLAGGPSWTVLLGRRDSLTANLAGA	HHHHHHHHHHHHHHHTT-------B--BB-S---HHHH	aaaaaaaaaaaaaaaavxxxbxxxbgxbxxabbbaaaa
1qgj_A_94	1qgj	A	94	131	CADILTLAARDSVVLSGGPGWRVALGRKDGLVANQNSA	HHHHHHHHHHHHHHTTT-------B---B-SS--HHHH	aaaaaaaaaaaaaaaavxxbbxxxbgxbxxabxbaaaa

PDB ligands within a cut-off distance of 6 Å in this subclass

Loop	PDB	Chain	Ligands	Residue
1gwu_A_97	1gwu	A	CACALCIUM ION	F - 130

Clusters included in this Subclass