Information on SUBCLASS 6.45.1 |
Subclass Accession number: 5910
Subclass: 6.45.1 Type: HE alpha-beta DB: ArchDB95 Image coordinates: Consensus coordinates: Conserved Annotation GO : GO:0003677 (>75 %) GO:0003700 (>75 %) GO:0003707 (>75 %) GO:0004872 (>75 %) GO:0004879 (>75 %) SCOP : 48507 (>75 %) 48508 (>75 %) 48509 (>75 %) |
Number of loops: 3 Average sequence ID (%) : 54.2 +/- 11.3 Average RMSD (Å) : 0.867 +/- 0.379 Consensus geometry
|
Consensus Sequence: | hRpcPXpcpL |
(φψ)-conformation: | aapbaaalbb |
Pattern: | x | x | x | x | x | x | x | x | x | x | x | x | x | x | x | x | x | x | x | x | x | x | x | x | x | x | x | x | x | x | x | x |
Conservation: | -0.755 | -0.925 | 1.966 | 1.286 | -1.435 | -0.074 | 0.606 | -0.415 | -0.074 | -0.415 | 0.096 | -0.244 | 0.096 | 1.286 | -0.074 | -0.244 | -1.435 | 0.606 | 1.286 | -1.095 | 0.606 | -0.585 | 1.286 | -0.925 | 0.266 | 2.647 | -1.265 | -0.585 | -0.415 | -0.755 | 0.606 | -0.925 |
Loops included in this Subclass |
Loop | PDB | Chain | Start | End | Sequence | Sec Struct | Ramachandran |
1nav_A_244 | 1nav | A | 244 | 275 | CEDQIILLKGCCMEIMSLRAAVRYDPESDTLT | HHHHHHHHHHHHHHHHHHHHHHT-BTTTTEEE | aaaaaaaaaaaaaaaaaaaaaaaxbaaalbbb |
1ovl_A_432 | 1ovl | A | 432 | 463 | KADQDLLFESAFLELFVLRLAYRSNPVEGKLI | HHHHHHHHHHHHHHHHHHHHHHHSBTTTTEEE | aaaaaaaaaaaaaaaaaaaaaaaxbaaavxbb |
1ovl_E_432 | 1ovl | E | 432 | 463 | KADQDLLFESAFLELFVLRLAYRSNPVEGKLI | HHHHHHHHHHHHHHHHHHHHHHHSBGGGTEEE | aaaaaaaaaaaaaaaaaaaaaaaxbaaavxxb |
PDB ligands within a cut-off distance of 6 Å in this subclass |
Clusters included in this Subclass |
CLUSTER: HE.6.312 |