Information on SUBCLASS 6.38.1 |
Subclass Accession number: 7563
Subclass: 6.38.1 Type: EH beta-alpha DB: ArchDB-EC Image coordinates: Consensus coordinates: |
Number of loops: 3 Average sequence ID (%) : 61.5 +/- -9.7 Average RMSD (Å) : 0.233 +/- 0.115 Consensus geometry
|
Consensus Sequence: | IXPXGApphX |
(φψ)-conformation: | bbpaapabaa |
Pattern: | [E] | [F] | [M] | [I] | x | [P] | [TV] | [G] | [A] | [KT] | [ST] | [FV] | [AKT] | [E] | [A] | [ILM] | [R] | [IM] | [G] | [ST] | [E] | [V] | [FY] | [H] | [HN] | [L] | [AK] | [AKS] | [LV] | [ILT] | [K] | [AK] |
Conservation: | 0.676 | 1.226 | 0.676 | 0.127 | -1.767 | 1.776 | -0.758 | 1.226 | 0.127 | -0.923 | -0.483 | -0.840 | -1.461 | 0.676 | 0.127 | -0.667 | 0.676 | -0.490 | 1.226 | -0.579 | 0.676 | 0.127 | 0.609 | 2.326 | 0.260 | 0.127 | -1.025 | -1.278 | -0.676 | -1.278 | 0.676 | -1.115 |
Loops included in this Subclass |
Loop | PDB | Chain | Start | End | Sequence | Sec Struct | Ramachandran |
1e9i_A_167 | 1e9i | A | 167 | 198 | EFMIQPVGAKTVKEAIRMGSEVFHHLAKVLKA | EEEEE-TT-SSHHHHHHHHHHHHHHHHHHHHH | bbbbbxaaxabaaaaaaaaaaaaaaaaaaaaa |
1one_A_168 | 1one | A | 168 | 199 | EFMIAPTGAKTFAEALRIGSEVYHNLKSLTKK | EEEEE-TT-SSHHHHHHHHHHHHHHHHHHHHH | bbbbbxaaxabaaaaaaaaaaaaaaaaaaaaa |
1pdz_*_166 | 1pdz | - | 166 | 197 | EFMILPTGATSFTEAMRMGTEVYHHLKAVIKA | EEEEE-TT-SSHHHHHHHHHHHHHHHHHHHHH | bbbbbxaaxabaaaaaaaaaaaaaaaaaaaaa |
PDB ligands within a cut-off distance of 6 Å in this subclass |
Loop | PDB | Chain | Ligands | Residue |
1e9i_A_167 | 1e9i | A | MGMAGNESIUM ION | E - 167 |
1one_A_168 | 1one | A | MGMAGNESIUM ION | E - 168 |
1one_A_168 | 1one | A | PEPPHOSPHOENOLPYRUVATE | E - 168 |
1one_A_168 | 1one | A | PAG2-PHOSPHO-D-GLYCERIC ACID | E - 168 |
1pdz_*_166 | 1pdz | * | PGA2-PHOSPHOGLYCOLIC ACID | E - 166 |
1pdz_*_166 | 1pdz | * | MNMANGANESE (II) ION | E - 166 |
Clusters included in this Subclass |
CLUSTER: EH.5.226 |