Information on SUBCLASS 1.2.21 |
Subclass Accession number: 8157
Subclass: 1.2.21 Type: HE alpha-beta DB: ArchDB-EC Image coordinates: Consensus coordinates: Conserved Annotation EC : 2.1 (>75 %) 2.1.1 (>75 %) 2.1.1.45 GO : GO:0008168 (>75 %) GO:0016741 (>75 %) GO:0042083 (>75 %) SCOP : 55830 (>75 %) 55831 (>75 %) 55832 (>75 %) |
Number of loops: 3 Average sequence ID (%) : 68.5 +/- -21.2 Average RMSD (Å) : 0.200 +/- 0.000 Consensus geometry
|
Consensus Sequence: | hXcLp |
(φψ)-conformation: | aalbb |
Pattern: | [G] | [V] | [P] | [F] | [N] | [I] | [A] | [S] | [Y] | [AS] | [IL] | [FL] | [T] | [CHY] | [M] | [I] | [A] | [HQ] | [IV] | [CT] | [DGN] | [L] | [DKQ] | [P] | [AG] | [DQ] | [F] | [I] | [H] | [TV] | [LM] | [G] | [DN] | [AC] | [H] | [IV] | [Y] |
Conservation: | 0.929 | -0.196 | 1.492 | 0.929 | 0.929 | -0.196 | -0.196 | -0.196 | 1.492 | -1.032 | -0.753 | -1.083 | 0.366 | -1.322 | 0.366 | -0.196 | -0.196 | -0.515 | -0.471 | -0.533 | -1.322 | -0.196 | -1.447 | 1.492 | -0.970 | -0.856 | 0.929 | -0.196 | 2.055 | -1.195 | -0.646 | 0.929 | -0.464 | -0.800 | 2.055 | -0.475 | 1.492 |
Loops included in this Subclass |
Loop | PDB | Chain | Start | End | Sequence | Sec Struct | Ramachandran |
1f28_A_206 | 1f28 | A | 206 | 242 | GVPFNIASYALLTCMIAHVCDLDPGDFIHVMGDCHIY | HHHHHHHHHHHHHHHHHHHTT-EEEEEEEEEEEEEEE | aaaaaaaaaaaaaaaaaaaavbbxFbbbbxbaxbbbx |
1hvy_A_222 | 1hvy | A | 222 | 258 | GVPFNIASYALLTYMIAHITGLKPGDFIHTLGDAHIY | HHHHHHHHHHHHHHHHHHHTT-EEEEEEEEEEEEEEE | aaaaaaaaaaaaaaaaaaaavbbwabbbxbbaxxbbx |
1j3k_C_517 | 1j3k | C | 517 | 553 | GVPFNIASYSIFTHMIAQVCNLQPAQFIHVLGNAHVY | HHHHHHHHHHHHHHHHHHHTT-EEEEEEEEEEEEEEE | aaaaaaaaaaaaaaaaaaaalbbxabbbbbbaxbbbx |
PDB ligands within a cut-off distance of 6 Å in this subclass |
Clusters included in this Subclass |
CLUSTER: HE.2.136 |