Information on SUBCLASS 7.21.1 |
Subclass Accession number: 8707
Subclass: 7.21.1 Type: HE alpha-beta DB: ArchDB-EC Image coordinates: Consensus coordinates: |
Number of loops: 3 Average sequence ID (%) : 76.3 +/- -35.4 Average RMSD (Å) : 0.200 +/- 0.000 Consensus geometry
|
Consensus Sequence: | NNDPhVGpKLK |
(φψ)-conformation: | aapaaaeaabb |
Pattern: | x | x | x | x | x | x | x | x | x | x | x | x | x | x | x | x | x | x | x | x | x | x | x | x | x | x | x | x | x | x | x |
Conservation: | 0.422 | -0.610 | -0.094 | 0.594 | -1.643 | -0.094 | -0.094 | -1.987 | -1.815 | -0.094 | -0.955 | -1.299 | -0.094 | -0.094 | 1.282 | -0.094 | -0.438 | 1.282 | 1.282 | 1.282 | 1.970 | -0.610 | -0.094 | 1.282 | -1.127 | 0.594 | -0.094 | 0.594 | -0.094 | -0.438 | 1.282 |
Loops included in this Subclass |
Loop | PDB | Chain | Start | End | Sequence | Sec Struct | Ramachandran |
1em6_A_614 | 1em6 | A | 614 | 644 | HMAKMIIKLITSVADVVNNDPMVGSKLKVIF | HHHHHHHHHHHHHHHHHHH-TTTGGGEEEEE | aaaaaaaaaaaaaaaaaaaxaaaeaabbbbx |
1l5r_A_614 | 1l5r | A | 614 | 644 | HMAKMIIKLITSVADVVNNDPMVGSKLKVIF | HHHHHHHHHHHHHHHHHHT-TTTGGGEEEEE | aaaaaaaaaaaaaaaaaaaxaaaeaabbbbb |
1l5w_A_579 | 1l5w | A | 579 | 609 | YLAKNIIFAINKVADVINNDPLVGDKLKVVF | HHHHHHHHHHHHHHHHHHT-TTTGGGEEEEE | aaaaaaaaaaaaaaaaaaaxaaaeaabbbbb |
PDB ligands within a cut-off distance of 6 Å in this subclass |
Loop | PDB | Chain | Ligands | Residue |
1l5r_A_614 | 1l5r | A | RBFRIBOFLAVINE | H - 614 |
1l5w_A_579 | 1l5w | A | GLCGLUCOSE | Y - 579 |
Clusters included in this Subclass |
CLUSTER: HE.7.137 |