Information on SUBCLASS 2.2.17 |
Subclass Accession number: 8933
Subclass: 2.2.17 Type: HH alpha-alpha DB: ArchDB-EC Image coordinates: Consensus coordinates: |
Number of loops: 3 Average sequence ID (%) : 22.2 +/- 26.1 Average RMSD (Å) : 0.767 +/- 0.306 Consensus geometry
|
Consensus Sequence: | hpGcXp |
(φψ)-conformation: | aalpaa |
Pattern: | x | [ER] | [AE] | [FM] | [SV] | [QY] | [EY] | [CMV] | [WY] | [EL] | x | [AS] | [AM] | [DHY] | [GY] | [ENR] | [FGL] | [KST] | [G] | [DN] | [FTW] | [ST] | [GK] | [FLV] | [DEG] | [EKT] | x | [GW] | [AKS] | [KV] | [LMT] | [ET] | [DGQ] |
Conservation: | -0.792 | 0.355 | -0.297 | 0.832 | -0.792 | 0.543 | 0.171 | -0.283 | 3.026 | -1.041 | -0.513 | 0.324 | -0.141 | -0.197 | -0.234 | -0.283 | -1.490 | -0.456 | 2.992 | 1.255 | -0.283 | 0.738 | -0.109 | -0.456 | -0.370 | -0.542 | -0.973 | 1.414 | -0.542 | -0.669 | -0.456 | -0.017 | -0.714 |
Loops included in this Subclass |
Loop | PDB | Chain | Start | End | Sequence | Sec Struct | Ramachandran |
1g9g_A_54 | 1g9g | A | 54 | 86 | SEAMSYYMWLEAMHGRFSGDFTGFDKSWSVTEQ | HHHHHHHHHHHHHHHHHHS--HHHHHHHHHHHH | avaaaaaaaaaaaaaaaavbaaaaaaaaaaaaa |
1jqo_A_55 | 1jqo | A | 57 | 89 | LREFVQECYEVSADYEGKGDTTKLGELGAKLTG | HHHHHHHHHHHHHHHHHH--THHHHHHHHHHHH | aaaaaaaaaaaaaaaaaavxaaaaaaaaaaaaa |
1l1y_A_86 | 1l1y | A | 86 | 118 | SEAFSYYVWLEAMYGNLTGNWSGVETAWKVMED | HHHHHHHHHHHHHHHHHHS--HHHHHHHHHHHH | aaaaaaaaaaaaaaaaaavxaaaaaaaaaaaaa |
PDB ligands within a cut-off distance of 6 Å in this subclass |
Loop | PDB | Chain | Ligands | Residue |
1g9g_A_54 | 1g9g | A | MGMAGNESIUM ION | E - 55 |
1l1y_A_86 | 1l1y | A | BGCBETA-D-GLUCOSE | E - 87 |
Clusters included in this Subclass |
CLUSTER: HH.2.139 |