ArchDB - Biological DataBase of Protein Loops

Information on SUBCLASS 10.13.1

Subclass Accession number: 9229
Subclass: 10.13.1

Type: HH alpha-alpha
DB: ArchDB-EC

Image coordinates:

Consensus coordinates:

Number of loops: 3

Average sequence ID (%) : 46.9 +/- 8.6
Average RMSD (Å) : 0.500 +/- 0.173

Consensus geometry

d (Å): 31

delta (°): 45-90

theta (°): 90-135

rho (°): 45-90

Consensus Sequence:	hpXXpIXXXSGpQE
(φψ)-conformation:	aapabbbbbpalaa

Pattern:	[F]	[EHR]	[KS]	[L]	[E]	[AEK]	[HY]	[AI]	[IL]	[DEQ]	x	[EGS]	[EQT]	[I]	x	x	[KPQ]	[S]	[G]	[KR]	[Q]	[E]	x	[L]	[EK]	[ST]	[IL]	[IL]	[N]	[QS]	[Y]	[IL]
Conservation:	1.627	-0.729	-0.438	0.449	1.038	-1.121	0.908	-0.973	-0.119	-0.336	-1.252	-1.187	-0.925	0.449	-1.252	-1.128	-0.925	0.449	1.627	0.185	1.038	1.038	-1.514	0.449	-0.079	-0.301	-0.107	-0.119	1.627	-0.481	2.216	-0.119

Loops included in this Subclass

Loop	PDB	Chain	Start	End	Sequence	Sec Struct	Ramachandran
1a0c_A_404	1a0c	A	404	435	FRSLEKYALERSQIVNKSGRQELLESILNQYL	HHHHHHHHHH----------HHHHHHHHHHHH	aaaaaaaaaaxabbbbbpalaaaaaaaaaaaa
1a0d_A_402	1a0d	A	402	433	FHKLEAHALQLGEIQNQSGRQERLKTLLNQYL	HHHHHHHHHT--S-------HHHHHHHHHHHH	aaaaaaaaaaxFxxbbbpavaaaaaaaaaaaa
1a0e_A_404	1a0e	A	404	435	FEKLEEYIIDKETIELPSGKQEYLESLINSYI	HHHHHHHHTT----------HHHHHHHHHHHH	aaaaaaaaaaxabbxbxxavaaaaaaaaaaaa

Clusters included in this Subclass