Logo
Information on SUBCLASS 1.1.59
Subclass Accession number: 995
Subclass: 1.1.59 PSSM
Type: EH beta-alpha
DB: ArchDB40

Image coordinates: Rasmol PDB Jmol PDB
Consensus coordinates: Rasmol PDB Jmol PDB

Conserved Annotation
GO : GO:0046914 (>75 %)  
SCOP : 54402 (>50 %)  54427 (>50 %)  
 Number of loops: 2

Average sequence ID (%) : 0.0 +/- 0.0
Average RMSD (Å) : 0.700 +/- 0.000

Consensus geometry
d (Å): 7 delta (°): 0-45 theta (°): 135-180 rho (°): 90-135
Consensus Sequence: hXXXp
(φψ)-conformation: bbpaa
Pattern: x[QS]x[VW][KW][FW][CT][EP][LT][ER][DT][AS]x[KQ][IW][AL]
Conservation:-0.356-0.071-1.495-0.0710.2142.7760.7830.214-0.6410.214-0.0710.214-1.4950.783-0.071-0.925
Loops included in this Subclass
LoopPDBChainStartEndSequenceSec StructRamachandran
1g5h_A_2041g5h   A211226ASLVWFTPTRTSSQWLEEEEEEE-HHHHHHHHbbbbbbbxaaaaaaaa
1ktg_A_1041ktg   A104119HQNWKWCELEDAIKIAEEEEEEE-HHHHHHHHbabbbxbxaaaaaaaa
PDB ligands within a cut-off distance of 6 Å in this subclass
LoopPDBChainLigandsResidue
1g5h_A_2041g5h   A     MSESELENOMETHIONINE L - 213
1g5h_A_2041g5h   A     MSESELENOMETHIONINE W - 229
1g5h_A_2041g5h   A     MSESELENOMETHIONINE H - 232
1g5h_A_2041g5h   A     MSESELENOMETHIONINE R - 233
1g5h_A_2041g5h   A     MSESELENOMETHIONINE W - 236
1g5h_A_2041g5h   A     MSESELENOMETHIONINE R - 238
1ktg_A_1041ktg   A     PO4PHOSPHATE ION H - 104
1ktg_A_1041ktg   A     MGMAGNESIUM ION H - 104
1ktg_A_1041ktg   A     MGMAGNESIUM ION E - 111

Clusters included in this Subclass
CLUSTER: EH.2.200