|
|
|
|
|
|
|
| Information on CLUSTER AR.9.62 |
Subclass Accession number: AR-9.23.1
DB: ArchDB95
| Loops included in this Cluster |
| Loop | PDB | Chain | Start | End | Sequence | Sec Struct | Ramachandran |
| 1fny_A_205 | 1fny | A | 205 | 235 | WVRFGFSATTGIDKGYVQTNDVLSWSFESNL | EEEEEEEEEE-SSTT-----EEEEEEEEEEE | bbbbebbbbbxaxpgxbbxbbxabbbbbbbb |
| 1gzc_A_207 | 1gzc | A | 207 | 237 | WVDVGLSGATGAQRDAAETHDVYSWSFQASL | EEEEEEEEEE-SSTT-----EEEEEEEEEEE | bbbbbbbbbbxabpvxbbxbxbabbbbbbbb |
| For any comment or web-related incidence, send an email to the webmaster. |
|