Logo
Information on 1col_A_56
Loop code: 1col_A_56
PDB: 1col
Chain: A
Type: HH alpha-alpha
Loop Start: 56  Loop Length: 8
Sec Struct Nt length: 12  Sec Struct Ct length: 12
Structure geometry
d (Å): 16.886499 delta (°): 49.581501theta (°): 133.233505 rho (°): 49.328499
Sequence:FDDAMASLNKITANPAMKINKADRDALVNAWK
Sec Struct:HHHHHHHHHHHHTSGGG---HHHHHHHHHHHH