Logo
Information on 1gof_*_53
Loop code: 1gof_*_53
PDB: 1gof
Chain: *
Type: AR beta-beta link
Loop Start: 53  Loop Length: 12
Sec Struct Nt length: 19  Sec Struct Ct length: 7
Structure geometry
d (Å): 14.706900 delta (°): 100.232002theta (°): 145.051193 rho (°): 295.328094
Sequence:HTYTIDMKTTQNVNGLSMLPRQDGNQNGWIGRHEVYLS
Sec Struct:EEEEEEEEEEEEEEEEEEE---SS--TT-B-EEEEEEE