Logo
Information on 1e9y_B_34
Loop code: 1e9y_B_34
PDB: 1e9y
Chain: B
Type: AR beta-beta link
Loop Start: 34  Loop Length: 32
Sec Struct Nt length: 2  Sec Struct Ct length: 10
Structure geometry
d (Å): 19.123400 delta (°): 60.975399theta (°): 132.658997 rho (°): 238.267807
Sequence:HDYTIYGEELKFGGGKTLREGMSQSNNPSKEELDLIITNALIVD
Sec Struct:EE-S-TT-----STTSS-SBTTTB-SS--TT--SEEEEEEEEEE