|
|
|
|
|
|
|
| Information on 1bbu_A_253 |
|
Loop code: 1bbu_A_253 PDB: 1bbu Chain: A Type: HA beta-beta hairpin |
Loop Start: 253 Loop Length: 11 Sec Struct Nt length: 9 Sec Struct Ct length: 10 Structure geometry
|
| Sequence: | RVFEINRNFRNEGISVRHNPEFTMMELYMA |
| Sec Struct: | EEEEEEEEE------SS--SEEEEEEEEEE |
| PDB ligands within a cut-off distance of 6 Å in this loop |
| Ligands | Residue | atSS | atLOOP |
| LYSLYSINE | N - 260 | 0 | 1 |
| LYSLYSINE | R - 262 | 0 | 1 |
| LYSLYSINE | M - 276 | 1 | 0 |
| LYSLYSINE | M - 277 | 1 | 0 |
| LYSLYSINE | E - 278 | 1 | 0 |
| LYSLYSINE | Y - 280 | 1 | 0 |
| For any comment or web-related incidence, send an email to the webmaster. |
|