Logo
Information on 2ak3_A_134
Loop code: 2ak3_A_134
PDB: 2ak3
Chain: A
Type: EH beta-alpha
Loop Start: 134  Loop Length: 26
Sec Struct Nt length: 4  Sec Struct Ct length: 25
Structure geometry
d (Å): 14.172300 delta (°): 71.074600theta (°): 63.619202 rho (°): 162.699295
Sequence:RVYNIEFNPPKTMGIDDLTGEPLVQREDDRPETVVKRLKAYEAQTEPVLEYYRKK
Sec Struct:EEEETTTB--SSTTB-TTT--B-B--GGGSHHHHHHHHHHHHHHHHHHHHHHHHH