|
|
|
|
|
|
|
| Information on 1eth_A_9 |
|
Loop code: 1eth_A_9 PDB: 1eth Chain: A Type: AR beta-beta link |
Loop Start: 9 Loop Length: 27 Sec Struct Nt length: 2 Sec Struct Ct length: 6 Structure geometry
|
| Sequence: | GCFSDDAPWAGIVQRPLKILPWSPKDVDTRFLLYT |
| Sec Struct: | EE----TTSSSSTTS-S------TTTS--EEEEEE |
| PDB ligands within a cut-off distance of 6 Å in this loop |
| Ligands | Residue | atSS | atLOOP |
| BMABETA-D-MANNOSE | C - 10 | 0 | 1 |
| BMABETA-D-MANNOSE | F - 11 | 0 | 1 |
| BMABETA-D-MANNOSE | S - 12 | 0 | 1 |
| BMABETA-D-MANNOSE | W - 17 | 0 | 1 |
| For any comment or web-related incidence, send an email to the webmaster. |
|