Logo
Information on 1msw_D_248
Loop code: 1msw_D_248
PDB: 1msw
Chain: D
Type: HE alpha-beta
Loop Start: 248  Loop Length: 35
Sec Struct Nt length: 14  Sec Struct Ct length: 2
Structure geometry
d (Å): 22.108900 delta (°): 37.602901theta (°): 141.362793 rho (°): 145.371399
Sequence:PEYAEAIATRAGALAGISPMFQPCVVPPKPWTGITGGGYWANGRRPLALVR
Sec Struct:HHHHHHHHHHHHHHTTS------BSS--B--SSSBS-BSSS--SS--BSEE