Logo
Information on 1msw_D_379
Loop code: 1msw_D_379
PDB: 1msw
Chain: D
Type: HE alpha-beta
Loop Start: 379  Loop Length: 15
Sec Struct Nt length: 24  Sec Struct Ct length: 4
Structure geometry
d (Å): 21.849501 delta (°): 76.543999theta (°): 141.519394 rho (°): 95.480202
Sequence:RAAAAVYRKDKARKSRRISLEFMLEQANKFANHKAIWFPYNMD
Sec Struct:HHHHHHHHHHHHHHHHHHHHHHHHTTTSSSSS-S-BB--EEEE