|
|
|
|
|
|
|
| Information on 1gx5_A_329 |
|
Loop code: 1gx5_A_329 PDB: 1gx5 Chain: A Type: HE alpha-beta |
Loop Start: 329 Loop Length: 26 Sec Struct Nt length: 13 Sec Struct Ct length: 6 Structure geometry
|
| Sequence: | TQEDAASLRVFTEATRYSAPPGDPPQPEYDLELITSCSSNVSVAH |
| Sec Struct: | HHHHHHHHHHHHH--TTS--BSS-----SSGGG--BTTBEEEEEE |
| PDB ligands within a cut-off distance of 6 Å in this loop |
| Ligands | Residue | atSS | atLOOP |
| MSESELENOMETHIONINE | D - 332 | 1 | 0 |
| MSESELENOMETHIONINE | S - 335 | 1 | 0 |
| MSESELENOMETHIONINE | L - 336 | 1 | 0 |
| MSESELENOMETHIONINE | V - 338 | 1 | 0 |
| MSESELENOMETHIONINE | F - 339 | 1 | 0 |
| MSESELENOMETHIONINE | T - 340 | 0 | 1 |
| MSESELENOMETHIONINE | E - 341 | 0 | 1 |
| MSESELENOMETHIONINE | A - 342 | 0 | 1 |
| MSESELENOMETHIONINE | P - 349 | 0 | 1 |
| For any comment or web-related incidence, send an email to the webmaster. |
|