Logo
Information on 1n5m_A_467
Loop code: 1n5m_A_467
PDB: 1n5m
Chain: A
Type: HE alpha-beta
Loop Start: 467  Loop Length: 22
Sec Struct Nt length: 20  Sec Struct Ct length: 5
Structure geometry
d (Å): 21.380501 delta (°): 114.951500theta (°): 134.971893 rho (°): 265.410309
Sequence:TEERIFAQRLMKYWTNFARTGDPNDPRDSKSPQWPPYTTAAQQYVSL
Sec Struct:HHHHHHHHHHHHHHHHHHHHS--S-SS--SS-----B-TTT-EEEEE