|
|
|
|
|
|
|
| Information on 1llf_A_177 |
|
Loop code: 1llf_A_177 PDB: 1llf Chain: A Type: HE alpha-beta |
Loop Start: 177 Loop Length: 5 Sec Struct Nt length: 16 Sec Struct Ct length: 11 Structure geometry
|
| Sequence: | AGLKDQRLGMQWVADNIAGFGGDPSKVTIFGE |
| Sec Struct: | HHHHHHHHHHHHHHHHGGGGTEEEEEEEEEEE |
| PDB ligands within a cut-off distance of 6 Å in this loop |
| Ligands | Residue | atSS | atLOOP |
| NAGN-ACETYL-D-GLUCOSAMINE | L - 179 | 1 | 0 |
| NAGN-ACETYL-D-GLUCOSAMINE | K - 180 | 1 | 0 |
| NAGN-ACETYL-D-GLUCOSAMINE | R - 183 | 1 | 0 |
| NAGN-ACETYL-D-GLUCOSAMINE | L - 184 | 1 | 0 |
| NAGN-ACETYL-D-GLUCOSAMINE | Q - 187 | 1 | 0 |
| F23TRICOSANOIC ACID | E - 208 | 1 | 0 |
| Associated ArchDB40 Subclass to 1llf_A_177 |
| Associated ArchDB95 Subclass to 1llf_A_177 |
| Associated ArchDB-EC Subclass to 1llf_A_177 |
| For any comment or web-related incidence, send an email to the webmaster. |
|