Logo
Information on 1smd_*_256
Loop code: 1smd_*_256
PDB: 1smd
Chain: *
Type: HE alpha-beta
Loop Start: 256  Loop Length: 25
Sec Struct Nt length: 11  Sec Struct Ct length: 3
Structure geometry
d (Å): 21.957300 delta (°): 161.337204theta (°): 45.906898 rho (°): 201.582993
Sequence:FKYGAKLGTVIRKWNGEKMSYLKNWGEGWGFMPSDRALV
Sec Struct:HHHHHHHHHHHTT-TT--GGGGGG-SGGGT---GGGEEE