|
|
|
|
|
|
|
| Information on 1mu5_A_387 |
|
Loop code: 1mu5_A_387 PDB: 1mu5 Chain: A Type: HE alpha-beta |
Loop Start: 387 Loop Length: 14 Sec Struct Nt length: 8 Sec Struct Ct length: 9 Structure geometry
|
| Sequence: | VIWKVVEELDWKRYGIESDQYQMVVMVHLCS |
| Sec Struct: | HHHHHHHHS-GGGGT--SS-B-EEEEEEEEE |
| PDB ligands within a cut-off distance of 6 Å in this loop |
| Ligands | Residue | atSS | atLOOP |
| CACALCIUM ION | V - 392 | 1 | 0 |
| CACALCIUM ION | E - 393 | 0 | 1 |
| CACALCIUM ION | E - 394 | 0 | 1 |
| CACALCIUM ION | L - 395 | 0 | 1 |
| CACALCIUM ION | D - 396 | 0 | 1 |
| CACALCIUM ION | W - 397 | 0 | 1 |
| For any comment or web-related incidence, send an email to the webmaster. |
|