|
|
|
|
|
|
|
| Information on 1fbt_A_148 |
|
Loop code: 1fbt_A_148 PDB: 1fbt Chain: A Type: HE alpha-beta |
Loop Start: 148 Loop Length: 16 Sec Struct Nt length: 6 Sec Struct Ct length: 8 Structure geometry
|
| Sequence: | CLLAYFLDKSSDELPYLKCPLHTVLKLTPV |
| Sec Struct: | HHHHHHTT--TTTGGG----TTEEEEEEEE |
| PDB ligands within a cut-off distance of 6 Å in this loop |
| Ligands | Residue | atSS | atLOOP |
| MSESELENOMETHIONINE | C - 148 | 1 | 0 |
| MSESELENOMETHIONINE | L - 149 | 1 | 0 |
| MSESELENOMETHIONINE | L - 150 | 1 | 0 |
| MSESELENOMETHIONINE | A - 151 | 1 | 0 |
| MSESELENOMETHIONINE | K - 165 | 0 | 1 |
| MSESELENOMETHIONINE | C - 166 | 0 | 1 |
| MSESELENOMETHIONINE | P - 167 | 0 | 1 |
| PO4PHOSPHATE ION | L - 168 | 0 | 1 |
| MSESELENOMETHIONINE | T - 170 | 0 | 1 |
| MSESELENOMETHIONINE | V - 171 | 1 | 0 |
| MSESELENOMETHIONINE | L - 172 | 1 | 0 |
| Associated ArchDB95 Subclass to 1fbt_A_148 |
| For any comment or web-related incidence, send an email to the webmaster. |
|