Logo
Information on 2src_*_360
Loop code: 2src_*_360
PDB: 2src
Chain: *
Type: HE alpha-beta
Loop Start: 360   Loop Length: 12
Sec Struct Nt length: 20   Sec Struct Ct length: 4
Structure geometry
d (Å): 11.3304 delta (°): 99.9999 theta (°): 99.9999 rho (°): 99.9999
Sequence: LPQLVDMAAQIASGMAYVERMNYVHRDLRAANILVG
Sec Struct: HHHHHHHHHHHHHHHHHHHHTT---S--SGGGEEEE
Associated ArchDB-KI Subclass to 2src_*_360

SUBCLASS: HE-11.1.1