|
|
|
|
|
|
|
| Information on 1i9z_A_769 |
|
Loop code: 1i9z_A_769 PDB: 1i9z Chain: A Type: HE alpha-beta |
Loop Start: 769 Loop Length: 40 Sec Struct Nt length: 7 Sec Struct Ct length: 6 Structure geometry
|
| Sequence: | QLNKQMLTGKVFPFFSELPITFPPTYKFDIGTDIYDTSDKHRVPAWTDRILYR |
| Sec Struct: | HHHHHHHTTSSSTT-B-----S---B-B-TTSS-B--STT----B--EEEEEE |
| PDB ligands within a cut-off distance of 6 Å in this loop |
| Ligands | Residue | atSS | atLOOP |
| 2IPD-MYO-INOSITOL-1,4-BISPHOSPHATE | Y - 794 | 0 | 1 |
| CACALCIUM ION | Y - 794 | 0 | 1 |
| 2IPD-MYO-INOSITOL-1,4-BISPHOSPHATE | K - 795 | 0 | 1 |
| 2IPD-MYO-INOSITOL-1,4-BISPHOSPHATE | R - 810 | 0 | 1 |
| For any comment or web-related incidence, send an email to the webmaster. |
|